KEGG   Camelus dromedarius (Arabian camel): 105092140
Entry
105092140         CDS       T04642                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04210  Apoptosis
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04926  Relaxin signaling pathway
cdk04931  Insulin resistance
cdk05132  Salmonella infection
cdk05134  Legionellosis
cdk05135  Yersinia infection
cdk05140  Leishmaniasis
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05171  Coronavirus disease - COVID-19
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    105092140 (NFKBIA)
   04668 TNF signaling pathway
    105092140 (NFKBIA)
   04024 cAMP signaling pathway
    105092140 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105092140 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105092140 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    105092140 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    105092140 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    105092140 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    105092140 (NFKBIA)
   04660 T cell receptor signaling pathway
    105092140 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    105092140 (NFKBIA)
   04659 Th17 cell differentiation
    105092140 (NFKBIA)
   04657 IL-17 signaling pathway
    105092140 (NFKBIA)
   04662 B cell receptor signaling pathway
    105092140 (NFKBIA)
   04062 Chemokine signaling pathway
    105092140 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105092140 (NFKBIA)
   04926 Relaxin signaling pathway
    105092140 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105092140 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105092140 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092140 (NFKBIA)
   05203 Viral carcinogenesis
    105092140 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105092140 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    105092140 (NFKBIA)
   05215 Prostate cancer
    105092140 (NFKBIA)
   05222 Small cell lung cancer
    105092140 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105092140 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105092140 (NFKBIA)
   05135 Yersinia infection
    105092140 (NFKBIA)
   05134 Legionellosis
    105092140 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105092140 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    105092140 (NFKBIA)
   05161 Hepatitis B
    105092140 (NFKBIA)
   05160 Hepatitis C
    105092140 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    105092140 (NFKBIA)
   05164 Influenza A
    105092140 (NFKBIA)
   05162 Measles
    105092140 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    105092140 (NFKBIA)
   05163 Human cytomegalovirus infection
    105092140 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105092140 (NFKBIA)
   05169 Epstein-Barr virus infection
    105092140 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105092140 (NFKBIA)
   05140 Leishmaniasis
    105092140 (NFKBIA)
   05142 Chagas disease
    105092140 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105092140 (NFKBIA)
   04131 Membrane trafficking [BR:cdk04131]
    105092140 (NFKBIA)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    105092140 (NFKBIA)
Membrane trafficking [BR:cdk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    105092140 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 105092140
NCBI-ProteinID: XP_010982098
LinkDB
Position
6
AA seq 314 aa
MFQPAEPGHEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEVLLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTRQTQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgttccagcccgccgagcccggccacgagtgggccatggagggccctcgggatgcgctc
aagaaggagcggctgctggacgaccgccacgatagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagcctcaggaggcgccg
cgcggcgccgaaccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgaccatggaagtagtccgccaagtaaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggtacttctggaagctggctgcgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagacccgccagacccagcacctccactccattctgcaggccaccaac
tacaatggccacacgtgtctgcacttagcctctatccacggctacctgggcatcgtggag
ctgttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccgaaccgcc
ctccatcttgcagtggacctgcagaatccagacctggtgtcgctcttgttgaagtgtgga
gctgatgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccaactgacactagagaaccttcagatgctg
ccagagagcgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg
ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system