KEGG   Camelus dromedarius (Arabian camel): 105092290Help
Entry
105092290         CDS       T04642                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase isoform X1
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04152  AMPK signaling pathway
cdk04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105092290 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    105092290 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105092290 (EEF2K)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     105092290 (EEF2K)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   105092290 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase Sel1
Motif
Other DBs
NCBI-GeneID: 105092290
NCBI-ProteinID: XP_031288925
LinkDB All DBs
Position
18
AA seq 752 aa AA seqDB search
MADEDLIFRLEGVDGGPTSRAAHDGDSGADSDDEEGYFICPITDDPRAHHNVNSKVNNYH
SNLRKSEPYGSSGSPAGSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATECATRHRYNAV
TGEWLQDEVLIKMASQPFGQGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCVIELKERLGQPLFHLEHYIEGKYIKYN
SNSGFVRDDNVRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTERGTDFGDGNL
GVRGMALFFHSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLLRLSENSGDENMSDVTSDSLPSSPSSATPHSQKLDALHWPVFTDLDN
AAPRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRRYESDEDSLGSCGR
AGFRSREDASSPSPSPLWPVNAWSSLQVCVEKWNLVNSSRLHLPRPSAVALEVQRLNALD
LEKKIGKSILGKVHLAMVRYHEGGRFCDKDEEWDRESAVFHLEHAADLGELEAIVGLGLM
YSQLPHHILADVSLEETEENKTKGFDFLLKAAEAGDRQSMILVARAFDTGQNLSPERSRN
WPEALHWYNTALEMTDCDEGGEYDGMQDEPRYTLLAREAEMLFTGGFGLEKDPQRSGDLY
TQAAEAAMEAMKGRLANQYYEKAEEAWAQMEE
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggcgtggatggcggccccacctcccgg
gctgcccacgacggtgattcgggcgcagacagcgacgacgaggaaggttacttcatttgc
cccatcaccgatgaccccagggcacaccacaatgtcaattccaaggttaataactaccac
agcaacctaaggaaaagtgagccctatggatccagcgggtccccggcaggttccttccat
tttaaggaagcctggaagcatgcaatcgagaaggccaagcacatgcccgacccttgggcc
gagttccacttggaggacattgccacggaatgtgccacacgtcacaggtacaatgctgtc
accggggagtggctgcaagatgaagttctgatcaagatggcgtctcagccctttggccaa
ggagcaatgagagagtgcttcaggacgaagaagctctccaacttcctgcacacccagcag
tggaagggggcctccaactacgtggcaaagcgctacatcgagtccgtggacagagacgtg
tactttgaggacgtgcgtctgcagatggaggccaagctctggggagaggagtataatcgg
cacaagccccccaaacaggtggacatcatgcagatgtgcgtcatagagctgaaggagaga
ctgggccagcctctcttccacctggagcactatattgagggcaagtacatcaagtacaac
tccaactcgggcttcgtccgcgatgacaacgtgcgcctgacgccgcaggccttcagccac
ttcacgtttgagcggtccggccaccagctgattgtggtggacatccagggtgtgggtgac
ctctacaccgacccgcagatccacaccgagaggggcactgactttggagatggcaaccta
ggtgtccgtgggatggctctcttcttccactctcacgcctgcaaccggatttgcaagagc
atgggcctcgctccattcgacctctccccaagagagagagatgccgtgaaccagaacacc
aagctgctgcaatcagccaaaaccattttgagggggacagaggaaaagtgcgggagcccc
cgggtaaggaccctctctggcagccggccccccctgctccttcgcctctcggagaactct
ggggacgagaacatgagtgacgtgacctccgactcgctcccttcctcgccgtcctcggcc
acgccgcacagccagaaactggacgccctccactggcctgtgttcactgaccttgataat
gcggctccccgagaccacgaccatctggacaaccaccgggactctgagaacagtggggac
agcggataccccagtgagaagcggggtgagctggatgacccagagccccgagaacatggc
cactcaaacggtaaccggaggtacgagtcggatgaagacagcctgggcagctgcggacgg
gctggctttcgtagccgggaggatgcatccagccccagcccctcacccctctggcctgta
aatgcctggtcctccctacaggtctgtgtggagaaatggaatctcgtcaactcctcccgc
ctccacctgcccaggccttcggccgtggccttggaggtgcagaggctcaacgctctggac
cttgagaagaagatcgggaagtccattctggggaaggtccacctggccatggtgcgctac
cacgagggcgggcgcttctgcgacaaggacgaggagtgggaccgggagtcggcggtcttc
cacctggagcacgcggccgacctgggcgagctggaggccatcgtgggcctggggctcatg
tactcgcagctgccccaccacatcctggccgatgtctctctggaggagacggaagagaat
aaaaccaaaggatttgatttcttactgaaagcagctgaagctggcgacagacagtccatg
atcctggtggcacgagcttttgacactggccagaacctcagcccagagaggtcccgaaac
tggccagaggctctgcactggtacaacactgccctggagatgacagactgtgatgagggc
ggtgagtatgatgggatgcaagacgagccccggtacacgctgctggccagggaggccgag
atgctgttcacaggcggcttcgggctggagaaggacccacagagatcaggcgacttgtac
acccaggcggccgaggcagcaatggaagccatgaagggccggctggccaaccagtactac
gagaaggcagaagaggcctgggcccagatggaggaataa

DBGET integrated database retrieval system