KEGG   Camelus dromedarius (Arabian camel): 105092576
Entry
105092576         CDS       T04642                                 

Gene name
SLC27A4
Definition
(RefSeq) LOW QUALITY PROTEIN: long-chain fatty acid transport protein 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04931  Insulin resistance
cdk04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105092576 (SLC27A4)
  09154 Digestive system
   04975 Fat digestion and absorption
    105092576 (SLC27A4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105092576 (SLC27A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105092576 (SLC27A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105092576 (SLC27A4)
Enzymes [BR:cdk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     105092576 (SLC27A4)
Lipid biosynthesis proteins [BR:cdk01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   105092576 (SLC27A4)
Transporters [BR:cdk02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   105092576 (SLC27A4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 105092576
NCBI-ProteinID: XP_031306472
LinkDB
Position
4
AA seq 643 aa
MLLGASLVGMLLFSKLVLKLPWTHVGFSLLFLYLGSGGWRFIRIFIKTIRRDIFGGIVLL
KVKAKVRRHLRERHTVPILFASTVQRHPDKTALIFEGTDTHWTFRQLDDYSSRVANFLQA
RGLASGDVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALHHCLTSSQARALIFG
SEMAPAVWEIHTSLDPLLSLFCSGPWEPSAVPAGTEHLDPLLEEAPKHLPSRPNKGFLDK
LFYIYTSGTTGLPKAAIVVHSRYYRMVALVYYGFRMQPDDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENRHRVRMALG
NGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDGQVGACGFNSRXLSSVYPIRLVR
VNENTMELIRGPDGVCLPCKPGEPGQLVGTIIQKDPLRRFDGYLNQGANNKKIAKDVFRK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVAKPFGSCDLEHFARLLDKELPLYARPIFLRFLPELHKTGTFKLQKME
LRKEGFDLKVVKDPLFYLDARKGRYVPLDQEAYTRIQAGEEKL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgctgcttggggcatctctggtggggatgctgctgttctccaagctggtgctgaaactt
ccttggacccatgtcgggttctccctgctgttcctctacctggggtctggcggctggcgc
ttcatccgaatcttcatcaagactatcagacgtgatatcttcggtggcatagtgctcctg
aaggtgaaggccaaggtccgccggcacctgcgggagcggcacacagtgcccatcttgttt
gcctccacggtccaacgtcaccctgacaagacggccctgatctttgagggcacggacacc
cactggaccttccgccagctagatgactactcaagccgcgtggccaacttcctgcaggcc
cggggcctggcctcgggtgatgtggttgccctcttcatggagaaccgcaatgagtttgtg
ggcctgtggctgggcatggccaagctgggcgtagaggcggcgctcatcaacaccaacctc
cggcgggatgccctgcaccactgcctgacctcctctcaggcccgggctctcatctttggc
agcgagatggccccagctgtctgggagatccacaccagcctggaccccttgctcagtctc
ttctgctccggtccctgggaacccagcgcggtgcccgctggcacagaacacctggacccc
ctgctggaagaggcccccaagcacctacccagccgccccaacaagggcttcttagataag
ctcttctacatctacacgtcaggtaccacaggactgcccaaagccgccatcgtggtgcac
agcaggtattaccgcatggttgccctggtgtactacggattccgcatgcagcctgacgac
attgtttatgactgcctccctctctaccactctgcaggaaacatcgtgggaatcgggcag
tgcctgctccacggcatgacagtggtgatccggaagaagttctcagcttcccggttctgg
gacgattgtatcaagtacaactgcacaattgtgcagtacatcggcgaactgtgccgctac
ctcctgaaccagccaccccgggaggcagaaaaccggcaccgggtgcgcatggcacttggc
aacggcctccgacagtccatctggaccgacttttctagccgcttccacatcccccaggtg
gccgagttctacggggccactgagtgcaactgcagcctgggcaacttcgatggccaggtg
ggggcctgtggcttcaacagccgcntcctgtcctctgtgtaccccatccggctggtacgt
gtcaacgagaacaccatggagctgatccggggacctgatggcgtttgcctcccctgcaag
ccaggtgagccaggccagctagtgggcaccatcatccagaaggaccccctgcggcgcttc
gatggctacctcaaccagggcgccaacaataagaagattgccaaggatgtcttcaggaag
ggggaccaggcctacctcactggcgatgtgctggtgatggacgagctgggctacctgtac
tttcgggaccgcacgggggacacgttccgctggaaaggggagaacgtgtccaccaccgag
gtggaaggcacgctcagccgtctgctggacatggctgacgtggcagtgtatggcgtcgag
gtgccaggaaccgagggccgggctggaatggctgctgtggccaagccctttggcagctgt
gacctggagcactttgcccgactcctggacaaggagctgcccctgtacgcccgccccatc
ttcctgcgcttcctgcctgagctgcacaaaacagggacttttaagttacagaagatggag
ctgcggaaggagggctttgacctgaaggttgtgaaagacccgctgttctacctggacgcg
cggaagggccgctatgtcccactggaccaagaggcctacacccgcatccaggcaggcgag
gagaagctgtga

KEGG   Camelus dromedarius (Arabian camel): 105101849
Entry
105101849         CDS       T04642                                 

Gene name
SLC27A1
Definition
(RefSeq) long-chain fatty acid transport protein 1
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04931  Insulin resistance
cdk04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105101849 (SLC27A1)
  09154 Digestive system
   04975 Fat digestion and absorption
    105101849 (SLC27A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105101849 (SLC27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105101849 (SLC27A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105101849 (SLC27A1)
Enzymes [BR:cdk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     105101849 (SLC27A1)
Lipid biosynthesis proteins [BR:cdk01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   105101849 (SLC27A1)
Transporters [BR:cdk02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   105101849 (SLC27A1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 105101849
NCBI-ProteinID: XP_010993394
LinkDB
Position
22
AA seq 646 aa
MRTPGAGSASMASLVLLWLLGLPWTWSTAAALGVYVGGGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAHHTIPQIFQAVARQQPEHLALVDAGSGVCWTFAQLDTYSNAVANLF
CQLGFTPGDVVALFLEGRPEFVGLWLGLAKAGVEAALLNVNLRREPLAFCLGTSGAKALV
FGVELAAAVAEVSGQLGKSLVKFCSGDLGPEGMLPDTQLLDPLLKEASTAPLAQPPGKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHAYSMQASDVLYDCLPLYHSAGNIMG
VGQCLIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLKQPVREAEGRHHVRL
AVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANVDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDAQGLCIPCQTGEPGLLVGQINQQDPLRRFDGYISESATNKKIAHSV
FHKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAIADPHGQLSPNALYQELQKVLAPYARPMFLRLLPQVDTTGTFKIQ
KTRLQREGFDPCQTSDRLFFLDLKQGHYLPLDQGVYTRICSGAFAL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcggactccgggtgcaggttcggcttccatggcctcgctggtgctgctatggttgctc
gggctgccgtggacctggagcacagcggcggcgctcggcgtgtacgttggcggcggcggc
tggcgtttcctgcgcatcgtctgcaaaaccgcgaggcgggacctcttcggcctctctgtg
ctgatccgtgtgcgcctggagctgcggcgacaccagcgtgcccaccacaccatcccgcaa
atcttccaggcggtggcccggcagcagcccgagcacctggcgctggtggatgcgggcagc
ggtgtgtgctggacctttgcacagctggatacctactctaacgctgtggccaacctcttc
tgccagctgggcttcacaccgggcgacgtggtggccctcttcctggagggccggccagag
ttcgtggggctgtggctgggcctggccaaggcgggtgtggaggccgcgctgcttaatgtt
aacctgcggcgggagcccctggccttctgtctgggcacctcaggcgccaaggccctggtc
ttcggagtggagctggcagcagcggtggccgaggtgagcggacagctgggcaagagtctg
gtcaaattctgttctggagacttggggcctgagggcatgttgccggacacccagcttctg
gacccactgttgaaagaggcctccacagcccccctggcacagccccctggcaagggcatg
gatgatcgactcttctacatctacacgtcggggaccacggggctgcccaaggctgccatc
gttgtgcacagcaggtactaccgcatcgcggcatttggccaccacgcctacagcatgcag
gcgtcagacgtcctctacgactgtctgcccctgtaccactctgcagggaacataatgggc
gtgggtcagtgtctcatctatgggctaactgtggtcctccgcaagaagttttcagccagc
cgcttctgggatgactgcgtcaagtacaactgcacggtggtccagtacattggggagatc
tgccgctacctgctgaagcagccagtgcgtgaggcagaagggcggcaccatgtgcgcctg
gcggtgggcaacggactgcggccagccatctgggaggagtttacggagcgcttcggcgtg
cgtcagattggcgagttctatggggccacggaatgtaactgcagcatcgccaatgtggac
gggaaggttggctcctgtggcttcaacagccgcatcctgccccatgtgtaccccatccgg
ctggtgaaggtcaatgaggacaccatggaactactgcgggatgcccagggtctctgcatc
ccatgccagaccggggagcccggcctcctcgtgggccagatcaaccagcaggacccgctg
cgtcgctttgatggctacatcagcgagagcgccaccaacaagaagatcgcccacagcgtt
ttccacaagggtgacagtgcctacctctcaggtgacgtgttggtgatggatgaactgggc
tacatgtacttccgggaccgcagcggggacaccttccgctggcgtggggagaatgtctct
accactgaggtggaaggcgtgctgagtcgtctgctgggccagacagatgtggccgtgtat
ggggtggctgtgccaggagtagagggcaaagcaggcatggcggccatcgcagatccccat
ggccagctgagccccaatgcgctgtaccaggagctgcagaaagtgctggccccctacgcc
aggccgatgttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagattcag
aagacgcggctgcagcgggagggcttcgacccatgccagacctcagaccggctcttcttc
ctggacctaaagcagggtcactacctgcctctggatcagggtgtctacacccgcatctgc
tcgggtgccttcgccctctga

DBGET integrated database retrieval system