KEGG   Camelus dromedarius (Arabian camel): 105092711
Entry
105092711         CDS       T04642                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04659  Th17 cell differentiation
cdk04919  Thyroid hormone signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05216  Thyroid cancer
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    105092711 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105092711 (RXRG)
   03320 PPAR signaling pathway
    105092711 (RXRG)
   04919 Thyroid hormone signaling pathway
    105092711 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    105092711 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092711 (RXRG)
   05202 Transcriptional misregulation in cancer
    105092711 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    105092711 (RXRG)
   05216 Thyroid cancer
    105092711 (RXRG)
   05222 Small cell lung cancer
    105092711 (RXRG)
   05223 Non-small cell lung cancer
    105092711 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105092711 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105092711 (RXRG)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    105092711 (RXRG)
Nuclear receptors [BR:cdk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   105092711 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 105092711
NCBI-ProteinID: XP_010982736
LinkDB
Position
21
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMSYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNTENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccaccggcttcggcggctcccccggc
cactctggctccacatccatgagcccatcggcagccttatctacagggaagccaatggac
agccaccccagctacacggacaccccagtgagtgccccacggactctgagtgcggtgggg
acccccctcaatgccctgggctctccgtatcgagtcatcacttctgccatgggcccaccg
tcaggagcgctggcagcccctccaggaatcaacttggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttctgaggacatcaagcccttaccggggcttcccggc
atcggaaacatgagctacccgtccactagccctggctctctggtcaaacacatctgtgcc
atctgtggggacagatcctcagggaagcactatggtgtgtacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatctacacgtgccgggacaataaagac
tgcctcattgacaagcgccagcgtaaccgatgccagtactgccgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagagaggcagagaagccgggagcgggca
gagagtgaggcagagtgtgccagcagcggccatgaagacatgcctgtggagaggattcta
gaagctgaacttgccgttgaaccaaagacggaatcctacggtgacatgaacacggaaaac
tcgacgaatgaccctgtcaccaacatatgccatgctgctgataagcagctgttcacgctc
gttgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctcatcgcctccttttcccaccgctcagtttct
gtgcaggatggcatccttctggccacgggtttacacgtccaccggagcagtgcccacagc
gctggggtcggctccatctttgacagagtcctcaccgagctggtctccaagatgaaagac
atgcagatggataagtcggagctggggtgcctgcgagccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctccgaggtagagactctgcgagagaaagtttacgccacc
ctcgaggcgtacaccaagcagaagtacccggaacagccaggcaggtttgccaaactgctg
ctgcgcctcccagccctgcgctccatcggcttgaaatgcctggagcaccttttcttcttc
aagctcatcggggacacgcccattgacactttcctcatggagatgttggagacccctctg
cagatcacctga

KEGG   Camelus dromedarius (Arabian camel): 105101393
Entry
105101393         CDS       T04642                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta
  KO
K08525  retinoid X receptor beta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04659  Th17 cell differentiation
cdk04919  Thyroid hormone signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05216  Thyroid cancer
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    105101393 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105101393 (RXRB)
   03320 PPAR signaling pathway
    105101393 (RXRB)
   04919 Thyroid hormone signaling pathway
    105101393 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    105101393 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101393 (RXRB)
   05202 Transcriptional misregulation in cancer
    105101393 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    105101393 (RXRB)
   05216 Thyroid cancer
    105101393 (RXRB)
   05222 Small cell lung cancer
    105101393 (RXRB)
   05223 Non-small cell lung cancer
    105101393 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105101393 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105101393 (RXRB)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    105101393 (RXRB)
Nuclear receptors [BR:cdk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   105101393 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 105101393
NCBI-ProteinID: XP_031290833
LinkDB
Position
20
AA seq 440 aa
MPQGSVGRWGCEKKCIVGSRPGGGGDGPGWIPQRRRRRQQPENNKPRSRSRGRLDGTGWA
TAGGINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHY
GVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQE
ERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGGGSSPNDPVT
NICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILL
ATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKG
LSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLI
GDTPIDTFLMEMLEAPHQLA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgccgcagggcagtgtgggccggtgggggtgcgaaaagaaatgcattgtggggtcgcgt
cccggtggcggcggcgacggccctggctggatcccgcagcggcggcggcggcggcagcag
ccggagaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgggcg
acagcgggcgggattaactcaacagtgtcgctccctgggggtgggtctggcccccctgaa
gatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggc
cctggggctggcaaacggctatgtgcaatctgcggggaccgaagctcaggcaaacactat
ggggtttacagctgtgagggctgcaaaggcttcttcaagcgcaccatccgtaaggacctg
acctactcatgccgggacaacaaagactgcacggtggacaagcgccagcggaaccgctgt
caatactgccgctatcaaaagtgcctggccactggcatgaagagggaggcggtacaggag
gagcgtcagcgggggaaggacaaagatggggatggggagggggctgggggagcccctgag
gagatgccggtggacaggatcctggaggcagagcttgctgtggaacagaagagtgaccag
ggcgttgagggtcctgggggaaccgggggtggcggcagcagcccaaatgacccagtgact
aacatctgtcaggcagctgacaagcagctattcacgcttgttgagtgggcgaagaggatc
ccacacttttcctccttgccgctggatgaccaggtcatactgctgcgggcaggctggaac
gagctcctcattgcctccttctctcaccgatccattgatgtccgagatggcatcctcctc
gccacaggtcttcacgtacaccgcaactcagcccattccgcaggcgtgggagccatcttt
gaccggtccctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatg
gacaagacagaacttggctgcctgagggcaatcattctgttcaacccagatgccaagggc
ctctccaaccccagtgaggtagaggtcctgcgggagaaagtgtatgcatcactggaaacc
tactgcaaacagaagtaccctgagcagcagggacggtttgccaagctgctgctgcgtctt
cctgctctcaggtccataggccttaagtgtctagagcatctgtttttcttcaagctcatt
ggtgacacccccattgacaccttcctcatggagatgcttgaggctccccaccagctggcc
tga

KEGG   Camelus dromedarius (Arabian camel): 105106306
Entry
105106306         CDS       T04642                                 

Gene name
RXRA
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04659  Th17 cell differentiation
cdk04919  Thyroid hormone signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
cdk04976  Bile secretion
cdk05160  Hepatitis C
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05216  Thyroid cancer
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105106306 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    105106306 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105106306 (RXRA)
   03320 PPAR signaling pathway
    105106306 (RXRA)
   04919 Thyroid hormone signaling pathway
    105106306 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    105106306 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    105106306 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105106306 (RXRA)
   05202 Transcriptional misregulation in cancer
    105106306 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    105106306 (RXRA)
   05216 Thyroid cancer
    105106306 (RXRA)
   05222 Small cell lung cancer
    105106306 (RXRA)
   05223 Non-small cell lung cancer
    105106306 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105106306 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    105106306 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105106306 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105106306 (RXRA)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    105106306 (RXRA)
Nuclear receptors [BR:cdk03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   105106306 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 105106306
NCBI-ProteinID: XP_031306796
LinkDB
Position
4
AA seq 486 aa
MDTKHFLPLDFSTQVTSSSLSSPTGRGSMAAPSLHPSLGPGIGSSLGAPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQWGCGSTFWPPGLTAVSPPQLSS
PMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVTAXEGCK
GFFKRTVRKVLSYTARDNKDCLIDKRQRNRCQYCRSTRMHGHGHEGETVQEERQRGKDRG
ENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANVGLNPSSPNDPVTNICQAADKQL
FTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNS
AHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKV
YASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLE
APHQMT
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctccacccaggtgacctcctcctccctc
agctcccccacagggcgcggctccatggctgccccctcgctgcacccctccctggggccc
ggcatcggctcctcgctcggcgcaccggggcagctgcactcgcccatcagcaccctgagc
tcccccatcaatggcatgggcccgcccttctccgtcatcagctcccccatgggcccccac
tccatgtcggtgcccaccacacccaccctgggtttcggcaccgggagcccgcagtggggg
tgtggcagcaccttctggcccccagggctgaccgcggtttcccctcctcagctcagctcc
cccatgaaccccgtcagcagcagcgaggacataaagcccccgctgggcctcaacggtgtc
ctcaaagtcccggcccacccctcagggaacatggcgtccttcaccaagcacatctgtgcc
atctgcggggaccgctcctcaggcaagcactacggggttacagcgnncgagggctgcaag
ggcttcttcaagcggacggtgcgcaaggtactgagctacactgcgcgggacaacaaggac
tgcctgatcgacaagcggcagcgcaaccgctgccagtactgccgatctaccagaatgcat
ggccatgggcatgaaggggaaaccgtgcaggaggagcggcagcggggcaaggaccggggg
gagaacgaggtggagtccacgagcagcgccaatgaggacatgccggtggagaagatcctg
gaggccgagctggccgtggagcccaagaccgagacgtacgtggaggcgaatgtggggctg
aaccccagctcgcccaacgaccccgtcaccaacatttgccaagcggcggacaagcagctg
ttcaccttggtggagtgggccaagcggatcccgcacttctccgagctgcccctggacgac
caggtcatcctgctgagggcaggctggaacgagctgctcatcgcgtccttctcccaccgc
tccatagccgtgaaggacggcatcctcctggccaccgggctgcacgtccaccgcaacagc
gcccacagcgcgggcgtgggcgccatctttgacagggtgctgacggagcttgtgtccaag
atgcgggacatgcagatggacaagacggagctgggctgcctgcgcgccatcgtcctcttc
aaccccgactccaaggggctctcgaacccggccgaggtggaggcgctccgtgagaaggtc
tacgcgtccctggaggcgtactgcaaacacaagtacccggagcagccaggaaggtttgcc
aagctcctgctgcgcctgccagccctgcgctccattggcctcaagtgcctggaacatctc
ttcttcttcaaactcattggggacacgcccatcgacaccttcctcatggagatgctggaa
gccccgcaccaaatgacttag

DBGET integrated database retrieval system