KEGG   Camelus dromedarius (Arabian camel): 105092770
Entry
105092770         CDS       T04642                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01524  Platinum drug resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04068  FoxO signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04217  Necroptosis
cdk04650  Natural killer cell mediated cytotoxicity
cdk04722  Neurotrophin signaling pathway
cdk04932  Non-alcoholic fatty liver disease
cdk04940  Type I diabetes mellitus
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05142  Chagas disease
cdk05143  African trypanosomiasis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05320  Autoimmune thyroid disease
cdk05330  Allograft rejection
cdk05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105092770 (FASLG)
   04014 Ras signaling pathway
    105092770 (FASLG)
   04068 FoxO signaling pathway
    105092770 (FASLG)
   04151 PI3K-Akt signaling pathway
    105092770 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105092770 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105092770 (FASLG)
   04217 Necroptosis
    105092770 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105092770 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105092770 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092770 (FASLG)
   05205 Proteoglycans in cancer
    105092770 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    105092770 (FASLG)
   05330 Allograft rejection
    105092770 (FASLG)
   05332 Graft-versus-host disease
    105092770 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    105092770 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105092770 (FASLG)
   04932 Non-alcoholic fatty liver disease
    105092770 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105092770 (FASLG)
   05161 Hepatitis B
    105092770 (FASLG)
   05160 Hepatitis C
    105092770 (FASLG)
   05164 Influenza A
    105092770 (FASLG)
   05162 Measles
    105092770 (FASLG)
   05168 Herpes simplex virus 1 infection
    105092770 (FASLG)
   05163 Human cytomegalovirus infection
    105092770 (FASLG)
   05165 Human papillomavirus infection
    105092770 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    105092770 (FASLG)
   05143 African trypanosomiasis
    105092770 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105092770 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105092770 (FASLG)
   04052 Cytokines and growth factors [BR:cdk04052]
    105092770 (FASLG)
   04090 CD molecules [BR:cdk04090]
    105092770 (FASLG)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105092770 (FASLG)
Cytokines and growth factors [BR:cdk04052]
 Cytokines
  Tumor necrosis fators
   105092770 (FASLG)
CD molecules [BR:cdk04090]
 Proteins
  105092770 (FASLG)
SSDB
Motif
Pfam: TNF LapA_dom GutM
Other DBs
NCBI-GeneID: 105092770
NCBI-ProteinID: XP_010982833
LinkDB
Position
21
AA seq 283 aa
MQQSLNYPYPPIFWVDSSASSPWASPRSVFPCPSSAPGRPGQGRPPPPPPPPPPPTLPPR
PPPPLPPLPLPPLKKRRDHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELREST
SQRQTASSLEKQIGQPHPPSEKRELRKVAHLTGKPSSRSIPLEWEDTYGIALVSGVKYKK
GSLVINDTGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSRYPQDLVLMEGKMMNYCTTGQM
WARSSYLGAVFNLTSADHLYVNVSELSLVNFEESKTFFGLYKL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcagcagtccctgaattacccataccccccaatcttctgggtggacagcagtgccagc
tctccctgggcctctccacggtcggtcttcccctgtccatcctctgcgccaggaaggcct
gggcaagggaggccaccaccgccgccaccaccaccaccaccaccaacactaccgccacgg
ccaccaccgccactgcctccactaccactgccacctctgaagaagaggagggaccacagc
acaggcctgtgtctccttgtgatgtttttcatggttctggtggccctggttggactgggg
ctggggatgtttcagctcttccacctgcagaaggagctggcggaactcagagagtccacc
agccaaaggcaaacagcctcatctttggagaagcaaataggtcagccccatccaccctct
gagaaaagagagctgaggaaagtggcccatttaacaggcaagcccagctcaaggtctatc
cctctggaatgggaagacacctacggaattgccctggtctctggggtgaagtataagaag
ggcagccttgtgatcaatgacaccgggctgtatttcgtgtattccaaagtgtacttccgg
ggccagtcctgcaacaaccagcccctgaaccacaaggtctacatgaggaactctaggtat
ccccaggacctggtgctgatggaggggaagatgatgaattactgcactactggccagatg
tgggcccgcagcagctacctgggggctgtgttcaatctcaccagtgctgaccatttatat
gtcaatgtatctgagctctctctggtcaattttgaggagtctaagacattttttggctta
tataagctctaa

DBGET integrated database retrieval system