KEGG   Camelus dromedarius (Arabian camel): 105092849
Entry
105092849         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 2J2-like
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk00591  Linoleic acid metabolism
cdk01100  Metabolic pathways
cdk04726  Serotonergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105092849
   00591 Linoleic acid metabolism
    105092849
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    105092849
  09156 Nervous system
   04726 Serotonergic synapse
    105092849
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105092849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105092849
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     105092849
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     105092849
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     105092849
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     105092849
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP2 family
   105092849
SSDB
Motif
Pfam: p450 Peptidase_C6
Other DBs
NCBI-GeneID: 105092849
NCBI-ProteinID: XP_031321435
LinkDB
Position
13
AA seq 484 aa
MSGAAVTLIKIHQVQFQSSSPKELTTAWAPAPLLVGHIFYLDFKKVHLSLQRFVKKYGNV
LRLEFGDLSSVVITGLPLIKEVLVHQGENFVNRPKAPFTERLFMNKGLIMSNGQEWKEQR
RFALMTLRNFGLGKKSLEERIQEEARYLTQAVGEEAGQPFDPNLKIKNAVSNIICSITFG
ERFDYQDDQFQELLRLLDEFMSLQTSICCQLYDVFPRIMNILPGPHQRIFSNWEKLKMFI
AHVIENHKRDWNPAEARDFIDAYLQEIEKHRGNATASFNEENLIHSTLDLFFAGTETTST
TLRWGLLYMALYPEIQEKVQAEIDRVLGQWQQPSTTARESMPYTNAVIHEVQRMGDIVPL
NVPREVTVDTTLAGYHLPKGIMVLSNLTALHTDPTVWATPDTFNPEHFLENGQFKKREAF
LPFSAGKRVCLGEQLARSELFIFFTSLVQKFTFRPPDNEKLSLKFKTGLTISPVTYRICA
VPRE
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtcaggtgctgccgttaccctgattaaaattcaccaggtgcagttccaatcatcgtcg
cccaaagaactaactaccgcctgggcccccgcgcctctgctcgtgggacacatcttctat
ctggactttaagaaggtccacctgtcgcttcagcggttcgtgaagaagtatgggaatgtt
cttaggctggaatttggtgatttgtcttcggttgtcataactggattgcccttaatcaaa
gaagtccttgtccaccagggcgaaaactttgtgaaccgccccaaagcccctttcacagaa
cgtctctttatgaacaaaggattgatcatgtccaatggccaggaatggaaggagcaaaga
aggtttgccctgatgacactgaggaactttggtttaggaaagaagagcttagaggaacgc
attcaggaagaggcccgctacctcacccaggcagtaggagaggaggctggacagcctttc
gacccaaacttgaaaatcaagaatgcggtatccaatattatctgctccatcacatttggg
gagcgttttgactaccaggatgatcagttccaggagttgctgaggctgttggacgagttc
atgagtctgcagacatcaatatgctgccagctctatgatgtctttccacggataatgaac
attctccctggaccccaccaaaggatctttagtaactgggagaaactgaaaatgttcatt
gcccatgtgattgaaaaccacaagagagactggaatcctgctgaagcaagagacttcatt
gatgcttacctccaggaaatagagaagcatagaggcaacgctactgcaagtttcaatgaa
gaaaacctcatccacagcaccctggacctcttcttcgctggaacggagacaacttcgacg
acgctgcgctggggtctgctctacatggccctgtaccccgaaatccaagaaaaagttcag
gctgagatcgacagggtacttggccaatggcagcagccgagcacaacagctcgagagtcc
atgccctacaccaacgctgtcattcacgaggtgcagagaatgggagacattgtccccctg
aacgtgcccagggaggtgacagtggacaccacgctggctggataccacctgcccaaggga
atcatggtcctgagcaacctgactgcactgcacacggaccccacagtgtgggccacccca
gacacgttcaatccggagcactttctggagaatggacagtttaagaaaagggaagctttt
ctgcctttctcagcaggaaagcgggtgtgccttggagagcagttggccaggtctgagttg
ttcatcttttttacttctcttgtgcaaaaattcaccttcaggcctccagacaatgagaag
ctgagcctgaagttcaaaacaggcctgaccatctccccagtcacctaccgcatctgtgct
gttcctcgggagtga

KEGG   Camelus dromedarius (Arabian camel): 105096275
Entry
105096275         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 2J2-like isoform X1
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk00591  Linoleic acid metabolism
cdk01100  Metabolic pathways
cdk04726  Serotonergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105096275
   00591 Linoleic acid metabolism
    105096275
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    105096275
  09156 Nervous system
   04726 Serotonergic synapse
    105096275
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105096275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105096275
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     105096275
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     105096275
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     105096275
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     105096275
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP2 family
   105096275
SSDB
Motif
Pfam: p450 Peptidase_C6
Other DBs
NCBI-GeneID: 105096275
NCBI-ProteinID: XP_010986864
LinkDB
Position
13
AA seq 502 aa
MLGSLGSLAAALWGVLSLRTLLLGAIAFLFFADFIRKRRPKNYPPGPLRLPFVGHLLHLD
FENVHLSLQRFVKKYGNVFRLEVGDFSSVVITGLPLIKEAFVHQGQNFANRPVTPFIERV
FKNKGLIMSNGQVWKEQRRFALMTLRNFGLGKKSLEECIQEEARYLTQAVGEVAGQPFDP
NIKIKNAVSNIICSITFGERFDYQNDQFQELLRLMDEITLLQESVSCQLYDIFPWIMNFL
PGSHQRVFRNWEKLKMFVAQVIENHKRDWNPAEARDFIDAYLQETEKHKGNATSSFDEEN
LIYITLDLFFAGTETTSTTLCWGLLYMALYPDIQEKVQAEIDRVIGQWQQPSTAARESMP
YTNAVIHEVQRMGNIVPLNVPREVMVDTTLAGYHLPKGTVVLTNLTALHRDPAEWATPDT
FNPEHFLENGQFKKREAFLPFSVGKRVCLGEQLARSELFIFFTYLVQKFTFRPPDNEKLS
LKFKTGLSLSPVTYRICAAPRA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcttgggtccttgggctccctggcggcggccctctggggggtgctcagtctccgcact
ctcctactgggtgccatagcctttcttttctttgctgatttcatcagaaaacggcgcccg
aagaactacccgcctgggcccctgcgcctgcccttcgtaggacacctcttacatctggac
tttgagaatgtgcacctgtcgcttcagcggtttgtgaagaaatatgggaatgtttttagg
ctggaagttggtgacttttcctccgttgttataactggattgcccttaatcaaagaagcc
tttgtgcaccagggccaaaactttgcgaaccgccccgtaactcctttcatagaacgtgtc
tttaagaacaaaggattgatcatgtccaatggccaggtatggaaggaacaaagaagattt
gccctgatgacactgaggaactttggtttaggaaagaagagcttagaggaatgcattcag
gaagaggcccgctacctcacccaggcagtaggagaggtggctggacagcctttcgacccc
aacatcaaaatcaagaatgcggtatccaatattatttgttccatcacatttggggagcgc
tttgactaccagaatgatcagttccaggagctgctgaggctaatggatgagatcacactt
ctgcaggaatcagtgtcctgccagctgtacgatatctttccgtggataatgaacttcctc
cctggatcccaccaaagggtctttagaaactgggagaaactgaaaatgtttgttgcccag
gtgattgaaaaccacaagagagactggaatcctgctgaagcaagagacttcattgatgct
tacctccaggaaacagagaagcataagggcaatgctacctcaagtttcgatgaagaaaac
cttatctatatcaccctggacctcttttttgctggaacagagacaacttcaacaacactg
tgctggggtctgctctacatggccctgtacccagacatccaagaaaaagtacaggctgag
attgacagggtgattggccaatggcagcagccgagcacggcagctcgagagtccatgccc
tacaccaacgctgtcatccacgaggtgcagagaatgggcaacattgttcccctgaacgtg
cccagggaggtgatggtggacaccacgctggctggataccacctgcccaagggaaccgtg
gtcctgaccaacctgactgcactgcacagggaccctgcagagtgggccaccccagacacg
ttcaatccggagcactttctggagaatggacagtttaagaaaagggaagcctttctgcct
ttctcagtaggaaagcgggtgtgccttggagagcagttggccaggtctgagttgttcatt
ttctttacttaccttgtgcaaaaattcaccttcaggcctccagacaatgagaagctgagc
ctgaaattcaaaacgggcctgagcctctccccagtgacctaccgcatctgtgctgctccc
cgggcatga

KEGG   Camelus dromedarius (Arabian camel): 105096288
Entry
105096288         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 2J2 isoform X1
  KO
K07418  cytochrome P450 family 2 subfamily J [EC:1.14.14.1 1.14.14.73 1.14.14.74 1.14.14.75]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk00591  Linoleic acid metabolism
cdk01100  Metabolic pathways
cdk04726  Serotonergic synapse
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105096288
   00591 Linoleic acid metabolism
    105096288
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    105096288
  09156 Nervous system
   04726 Serotonergic synapse
    105096288
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    105096288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105096288
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     105096288
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     105096288
    1.14.14.74  albendazole monooxygenase (hydroxylating)
     105096288
    1.14.14.75  fenbendazole monooxygenase (4'-hydroxylating)
     105096288
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP2 family
   105096288
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105096288
NCBI-ProteinID: XP_031321102
LinkDB
Position
13
AA seq 502 aa
MLAVVGSLAEALWGLLRLRTLLLGAVVFLFFADFLKRRRPKNYPPGPPSLPFVGHLFHLD
LQKGHLSVQRFVKKYGELFRLDVGDLVSVVITGLPLIKEALVHQGQNFVNRPITPLREHV
FKENGLIMSNGQVWKEQRRFTLMTLRNFGLGKKSLEEHIQEEARYLTQAIGEEDGQPFNP
HFKINNAVSNIICSITFGERFDYKDDQFQELLRLLDEATYLETSMWCQLYNVFRLIMNFL
PGPHQRLFRNWEKLKMFVARVIENHKRDWNPAEARDFIDAYLQEIEKHRGNATSSFNEEN
LISSTLDLFFAGTETTSTTLRWGLLYMAFYPEIQEKVQAEIDRVLGQWQQPSTAARESMP
YTNAVIHEVQRMGNIVPLNVPREVIVDTTLAGYHLPKGTTVLTNLTALHTDPTAWATPDT
FNPEHFLENGQFKKREDFLPFSVGKRVCLGEQLARSELFIFFTSLVQKFTFRPPDNEKLS
LKFRMGLTISPVPYRICAVPRE
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgctcgcggtggtgggctccctggcggaggccctctgggggctgctccgtctccgcact
ctcctgctgggtgccgtcgtatttctcttctttgctgatttcctcaaaaggcggcgccca
aagaactacccgcctgggcccccgagcctgcccttcgtgggacacctctttcatctggac
ttacagaaggggcacctgtcggttcagcggtttgtgaagaaatacggggaactttttcgc
ctggacgtcggtgacttggtttcagttgttataactggattgcccttaatcaaagaagcc
cttgtccaccagggccaaaactttgtgaaccgccccataacccctcttcgagaacatgtc
tttaaggaaaatggattgatcatgtccaatggccaggtgtggaaggaacaaagaagattc
accctgatgacactgaggaactttggtttaggaaagaagagcttagaggaacacattcag
gaagaggcccgctacctcacccaggcaataggagaggaggacggacagcctttcaaccct
cacttcaaaatcaacaatgcagtttccaatattatttgctccatcacatttggggagcgc
tttgactacaaggatgatcagttccaggagctgctgaggctgttggatgaggccacgtat
ctggagacatcaatgtggtgccagctttacaatgtttttcggctgataatgaatttcctc
cctggaccccaccaaaggctctttcgtaactgggagaaactgaaaatgttcgttgccaga
gtgattgaaaaccacaagagagactggaatcctgccgaagcaagagacttcattgatgct
tacctccaggaaatagagaagcatagaggcaatgctacctcaagtttcaatgaagaaaac
ctcatctccagcaccctggacctcttcttcgctggaacggagacaacttcgacgacgctg
cgctggggtctgctctacatggccttctacccagaaatccaagaaaaagtacaggctgag
attgacagggtacttggccaatggcagcagccgagcacagcagctcgggagtccatgccc
tacaccaacgctgtcatccacgaggtgcagagaatgggcaacatcgtccccctgaacgtg
cccagggaggtgatagtggacaccacgctggctggataccacctgcccaagggaactaca
gtcctgaccaacctgaccgcactgcacacggaccccacagcgtgggccaccccagacacg
ttcaatccggagcactttctggagaatggacagtttaaaaaaagggaagactttctgcct
ttctcagtaggaaagcgggtgtgccttggagagcagctggccaggtctgaattgttcatt
ttctttacttcccttgtgcaaaaattcaccttcaggcctccagacaatgagaagctgagc
ctcaagttcagaatgggcctgaccatctccccagttccctaccgcatctgtgctgttccc
cgggagtga

DBGET integrated database retrieval system