KEGG   Camelus dromedarius (Arabian camel): 105092930
Entry
105092930         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 4B1 isoform X3
  KO
K07426  cytochrome P450 family 4 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105092930
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     105092930
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP4 family
   105092930
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105092930
NCBI-ProteinID: XP_010983009
LinkDB
Position
13
AA seq 511 aa
MVTALLPLSISRLGLWAFGLILVLGFLKLIRLLLRRQMLARAIDSFPGPPTHWLFGHALE
IQQTGSLDKVVSWTHQFPYAHQLWVGPFLGFLNIYEPDYAKAVYGRGDPKAPDVYDFFLQ
WIGKGLLVLHGPKWYQHRKLLTPGFHYDVLKPYVALFAESTHVMLDKWEEKALKNKSFDI
FSDVGHMALDSLMKCTFGKGNVGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLT
PHGRRFLRACQVAHDHTDQVIRERKAALQDEKEWKKIQNRRHLDFLDILLGARDEDGIKL
SDADLRAEVDTFMFEGHDTTTSGISWILYCMAQYPEHQHRCREEIREILGDRDSIQWDDL
GKMTYLTMFMKETFRLYPPVPQVYRQLSKPVSFVDGRSLPAGSLISLHIYALHRNSTVWP
DPEVFDPLRFSPENIAGRHPFAFIPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFALDP
SKVPIKLPQLVLRSKNGIHLHLKPLRPGSGK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggtgactgctctgctccccctgagcatttcccgcctgggcctgtgggcttttggactg
atcttggttttaggcttcctcaagctcattcgtctgctgctacggaggcagatgctggcc
cgggctatagacagcttcccaggtcctcccacccactggcttttcgggcatgccctcgag
atccagcagacggggagcctggacaaggtggtatcctggacccaccagttcccctacgcc
caccaactctgggtgggaccgttccttggcttcctgaacatctacgagcctgactatgcc
aaagcagtgtacggccgtggagaccctaaggccccagatgtgtacgacttcttcctccag
tggattgggaaaggcttgctggtcctccacgggcccaagtggtatcagcaccgcaagctg
ctcacacctggcttccactatgatgtgctgaagccctatgtggccctgttcgctgagtcc
acacacgtcatgctggacaagtgggaagaaaaggctcttaagaataagagctttgacatc
ttcagcgatgtgggccacatggcgctggactcactcatgaagtgcacctttggcaaaggg
aacgtcggcctgagccacagtgacaatagctattacctggcggtgagcgatctcactctg
ctgatgcagcagcgcatcgattcattccagtaccataacgacttcatctactggctcacc
ccgcacggccgcaggttcctgcgggcctgccaggtggcccacgaccacacagaccaggtc
atcagggaacggaaggcagccctgcaggatgagaaagagtggaagaagatccagaaccgg
aggcacctggacttcctggacatcctcctgggggctcgggatgaagatgggatcaaactg
tcagatgcagacctccgggccgaggtggacacattcatgttcgaaggccatgacaccacc
accagtggcatctcctggattctctactgcatggctcagtaccctgagcaccagcatcgt
tgtcgggaggagatccgtgagattcttggggaccgagactccatccagtgggatgatctg
gggaagatgacctacctgaccatgttcatgaaggagaccttccgcctctacccgcctgtg
ccgcaggtgtaccgtcagctcagcaagcctgtcagctttgtggatggccgctctctcccc
gcaggcagcctgatctctctgcacatctatgccctccataggaacagtacagtgtggccc
gaccctgaggtcttcgaccccctgcgcttttctcctgagaatatagctggacgccacccc
tttgccttcattcccttctctgctgggcccaggaactgcattgggcagcagtttgccatg
aacgagatgaaggtggtcacggccctctgcttgctccgttttgaatttgccctggacccc
tcgaaggtgcccatcaagctgccccagctagtcctgcgttccaagaatggtattcacctc
cacctgaagccgctgcgcccgggctctgggaagtag

DBGET integrated database retrieval system