KEGG   Camelus dromedarius (Arabian camel): 105093074Help
Entry
105093074         CDS       T04642                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05034  Alcoholism
cdk05165  Human papillomavirus infection
cdk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    105093074 (HDAC11)
  09164 Substance dependence
   05034 Alcoholism
    105093074 (HDAC11)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    105093074 (HDAC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105093074 (HDAC11)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105093074 (HDAC11)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     105093074 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 105093074
NCBI-ProteinID: XP_010983171
LinkDB All DBs
Position
Un
AA seq 347 aa AA seqDB search
MPHPTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVISFLKEEKLLSDSML
VEAREASDEDLLVVHTRRYLSELKWSFAVAAITEIPPVIFLPNFLVQRKVLKPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGVSRATIVDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRLAKQAIRRKVELEWGTEDDEYLSKVER
NLERALKEHQPDVVVYNAGTDILEGDRLGGLSISPQGVVRRDELVFRMVRGRQVPILMVT
SGGYQKRTARIIADSILNLHGVGLIGPEAASVSAQNSDTPLLPPEVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccacacccaacccagctgtaccagcatgtgccggagacacgctggcccatcgtgtac
tcgccgcgctacaacatcaccttcatgggcctggagaagctgcacccctttgacgcagga
aaatggggcaaagtgatcagcttcctgaaagaagagaagctcctgtcggacagcatgctg
gtggaggcgcgggaggcctcggacgaagatctgctggtggtgcacacgcggcgctatctc
agcgagctcaagtggtcctttgcggttgcagccattacggagatcccccctgtcatcttc
ctgcccaacttcctcgtgcaaaggaaggtgctgaagcccctgcggacccagacgggagga
accataatggcggggaagctggccgtggagcgaggctgggccatcaacgtgggtggaggc
ttccaccactgctccagcgaccggggcgggggcttctgcgcctacgcggacatcacgctg
gccattaagtttctgtttgaacgagtggagggcgtctctagggccaccatcgtggatctg
gatgcccatcagggcaatgggcacgagcgggacttcatgggtgacaagcgcgtgtacatc
atggacgtctacaatcgccacatctaccccggcgaccgccttgccaagcaggccatcagg
aggaaggtggagctggaatggggcacggaggatgacgaatacctgagtaaagtggagagg
aacctggagagagccctcaaggagcatcagcctgacgtggttgtgtacaatgcgggcacg
gacatcctcgagggtgaccgccttggggggctgtccatcagcccgcagggcgtcgtgagg
cgagatgagctggtgttccggatggtccgaggccgccaggtacccatcctcatggtgacc
tcgggcgggtaccagaagcgcacggcccgcatcatcgccgactccatccttaatttgcat
ggcgtggggctcatcgggcctgaggcagccagcgtctcggcacagaactcagacacccct
ctgctgcccccggaggtgccctga

DBGET integrated database retrieval system