KEGG   Camelus dromedarius (Arabian camel): 105093103Help
Entry
105093103         CDS       T04642                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X1
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04380  Osteoclast differentiation
cdk04714  Thermogenesis
cdk05016  Huntington disease
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105093103 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105093103 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105093103 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    105093103 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    105093103 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093103 (PPARG)
   05202 Transcriptional misregulation in cancer
    105093103 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    105093103 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105093103 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105093103 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105093103 (PPARG)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    105093103 (PPARG)
Nuclear receptors [BR:cdk03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   105093103 (PPARG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 105093103
NCBI-ProteinID: XP_010983222
LinkDB All DBs
Position
17
AA seq 505 aa AA seqDB search
MGETLGDSLIDPESDSFAGALSAHTSQEITMVDTEMPFWPTSFGISSVDLSMVDDHSHAF
DIKPFTTVDFSSISTPHYEDVPFPRADPMVADYKYDLKLQEYQSAIKVEPVSPPYYAEKT
QLYNRPHEEPCSSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaccctgggagattctcttattgacccagaaagcgattcctttgctggtgca
ctgtctgcacacacttcacaagaaattacgatggttgacaccgagatgccgttctggccc
accagcttcggcatcagctccgtggacctgtccatggtggacgaccactcccacgccttt
gacatcaagcccttcaccactgttgatttctccagcatttccactccgcactacgaagac
gttccattcccaagagctgacccgatggttgcggattataagtacgacctgaagctccaa
gagtaccaaagtgccatcaaagtggagcccgtctccccaccttactatgctgagaagact
cagctgtacaacaggcctcacgaggagccctgcagctccctcatggccatcgagtgccgc
gtctgcggggacaaggcttccggcttccactacggcgttcacgcctgcgaaggctgcaag
ggtttcttccggagaacaattagattgaagcttatttatgataggtgtgatctgaactgt
cggatccacaaaaaaagtagaaataaatgccagtactgtcggtttcagaaatgccttgct
gtggggatgtctcacaatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcagagatctccagtgatatcgaccaactgaacccagagtcggcggatctccgg
gccctggcaaaacacttgtatgactcatacataaagtccttcccgctgaccaaagccaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccatttgtcatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccctgcaggag
cagagcaaagaggtggccatccgcatctttcaggggtgtcagtttcgctccgtggaagcc
gtgcaagagatcacagagtacgccaagagtattcctgggtttgtaaaccttgacttgaat
gaccaagtaactctcctaaaatacggcgtccacgagatcatttacacgatgctggcctcc
ttgatgaataaagatggggttctcatttccgaaggccaaggattcatgaccagggagttt
ctaaagagcctgagaaagccctttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaacgcactggaactggatgacagcgacctggcgatatttatagctgtcattatt
ctcagtggagaccgccccggtttgctgaatgtgaagcccattgaggacatccaggacaac
ttgctgcaagccttagagctgcagctcaagctgaaccaccccgagtcctctcagctcttt
gccaagctgctgcagaaaatgacagacctcaggcagattgtgacagagcacgtgcagctg
ttgcaagtcataaagaaaacagagacggacatgagtcttcacccgctcctacaggaaata
tacaaggacttgtattag

DBGET integrated database retrieval system