KEGG   Camelus dromedarius (Arabian camel): 105093393Help
Entry
105093393         CDS       T04642                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04370  VEGF signaling pathway
cdk04371  Apelin signaling pathway
cdk04380  Osteoclast differentiation
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04611  Platelet activation
cdk04620  Toll-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  Jak-STAT signaling pathway
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04668  TNF signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk04973  Carbohydrate digestion and absorption
cdk05010  Alzheimer disease
cdk05017  Spinocerebellar ataxia
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease (American trypanosomiasis)
cdk05145  Toxoplasmosis
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105093393 (AKT2)
   04015 Rap1 signaling pathway
    105093393 (AKT2)
   04010 MAPK signaling pathway
    105093393 (AKT2)
   04012 ErbB signaling pathway
    105093393 (AKT2)
   04370 VEGF signaling pathway
    105093393 (AKT2)
   04371 Apelin signaling pathway
    105093393 (AKT2)
   04630 Jak-STAT signaling pathway
    105093393 (AKT2)
   04668 TNF signaling pathway
    105093393 (AKT2)
   04066 HIF-1 signaling pathway
    105093393 (AKT2)
   04068 FoxO signaling pathway
    105093393 (AKT2)
   04072 Phospholipase D signaling pathway
    105093393 (AKT2)
   04071 Sphingolipid signaling pathway
    105093393 (AKT2)
   04024 cAMP signaling pathway
    105093393 (AKT2)
   04022 cGMP-PKG signaling pathway
    105093393 (AKT2)
   04151 PI3K-Akt signaling pathway
    105093393 (AKT2)
   04152 AMPK signaling pathway
    105093393 (AKT2)
   04150 mTOR signaling pathway
    105093393 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105093393 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    105093393 (AKT2)
   04218 Cellular senescence
    105093393 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105093393 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    105093393 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105093393 (AKT2)
   04620 Toll-like receptor signaling pathway
    105093393 (AKT2)
   04625 C-type lectin receptor signaling pathway
    105093393 (AKT2)
   04660 T cell receptor signaling pathway
    105093393 (AKT2)
   04662 B cell receptor signaling pathway
    105093393 (AKT2)
   04664 Fc epsilon RI signaling pathway
    105093393 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    105093393 (AKT2)
   04062 Chemokine signaling pathway
    105093393 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105093393 (AKT2)
   04922 Glucagon signaling pathway
    105093393 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    105093393 (AKT2)
   04920 Adipocytokine signaling pathway
    105093393 (AKT2)
   04929 GnRH secretion
    105093393 (AKT2)
   04915 Estrogen signaling pathway
    105093393 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    105093393 (AKT2)
   04917 Prolactin signaling pathway
    105093393 (AKT2)
   04926 Relaxin signaling pathway
    105093393 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    105093393 (AKT2)
   04919 Thyroid hormone signaling pathway
    105093393 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105093393 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105093393 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    105093393 (AKT2)
   04728 Dopaminergic synapse
    105093393 (AKT2)
   04722 Neurotrophin signaling pathway
    105093393 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105093393 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    105093393 (AKT2)
   04213 Longevity regulating pathway - multiple species
    105093393 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093393 (AKT2)
   05205 Proteoglycans in cancer
    105093393 (AKT2)
   05230 Central carbon metabolism in cancer
    105093393 (AKT2)
   05231 Choline metabolism in cancer
    105093393 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105093393 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105093393 (AKT2)
   05212 Pancreatic cancer
    105093393 (AKT2)
   05225 Hepatocellular carcinoma
    105093393 (AKT2)
   05226 Gastric cancer
    105093393 (AKT2)
   05214 Glioma
    105093393 (AKT2)
   05221 Acute myeloid leukemia
    105093393 (AKT2)
   05220 Chronic myeloid leukemia
    105093393 (AKT2)
   05218 Melanoma
    105093393 (AKT2)
   05211 Renal cell carcinoma
    105093393 (AKT2)
   05215 Prostate cancer
    105093393 (AKT2)
   05213 Endometrial cancer
    105093393 (AKT2)
   05224 Breast cancer
    105093393 (AKT2)
   05222 Small cell lung cancer
    105093393 (AKT2)
   05223 Non-small cell lung cancer
    105093393 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105093393 (AKT2)
   05017 Spinocerebellar ataxia
    105093393 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105093393 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105093393 (AKT2)
   04931 Insulin resistance
    105093393 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105093393 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105093393 (AKT2)
   05135 Yersinia infection
    105093393 (AKT2)
   05152 Tuberculosis
    105093393 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105093393 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    105093393 (AKT2)
   05162 Measles
    105093393 (AKT2)
   05164 Influenza A
    105093393 (AKT2)
   05161 Hepatitis B
    105093393 (AKT2)
   05160 Hepatitis C
    105093393 (AKT2)
   05168 Herpes simplex virus 1 infection
    105093393 (AKT2)
   05163 Human cytomegalovirus infection
    105093393 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105093393 (AKT2)
   05169 Epstein-Barr virus infection
    105093393 (AKT2)
   05165 Human papillomavirus infection
    105093393 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105093393 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    105093393 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105093393 (AKT2)
   01524 Platinum drug resistance
    105093393 (AKT2)
   01522 Endocrine resistance
    105093393 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105093393 (AKT2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105093393 (AKT2)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105093393 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C
Motif
Other DBs
NCBI-GeneID: 105093393
NCBI-ProteinID: XP_031314558
LinkDB All DBs
Position
9
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagcgatggctccttcattggatacaaggag
cggcccgaagcccccgaccagactctgccccccttaaacaacttctctgttgcagaatgc
cagctgatgaagaccgagagaccacggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttccatgtagactctccggatgagagggaggagtggatg
cgggccatccagatggttgccaacagtctcaagcagcggggcccaggtgaggaccccatg
gactacaagtgtggctcccctagcgactcttctgcggctgaggagatggaggtggcagtt
agcaaggctcgggccaaggtgaccatgaacgacttcgactatctcaaactcctgggcaag
ggcacctttggcaaggtcatcctggtgcgggaaaaggccaccggccgctactatgccatg
aagatcctgcggaaggaggttatcatcgccaaggatgaagtcgcccacacagttaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtatgccttccag
acccacgaccgcctgtgcttcgtgatggagtatgccaacggcggtgagctgttcttccac
ctgtcccgggagcgcgtcttcacggaggagcgggcccgcttctacggcgcggagatcgtc
tcggccctggagtacctgcactcacgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacccctgagtacctggcacctgag
gtgctggaggacaacgactatggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccacgcacgctcggccccgaggccaagtccctg
cttgcggggctgctcaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagtgtcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggttgacacaaggtactttgac
gatgagttcaccgcccagtccatcacgatcacccccccggaccgctatgacagcctgggc
tcgctcgaactggaccagcggacccacttcccccagttctcctattcggccagcatccga
gagtga

DBGET integrated database retrieval system