KEGG   Camelus dromedarius (Arabian camel): 105093664
Entry
105093664         CDS       T04642                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2 precursor
  KO
K05429  interleukin 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04061  Viral protein interaction with cytokine and cytokine receptor
cdk04151  PI3K-Akt signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04672  Intestinal immune network for IgA production
cdk04940  Type I diabetes mellitus
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05162  Measles
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05320  Autoimmune thyroid disease
cdk05321  Inflammatory bowel disease
cdk05330  Allograft rejection
cdk05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105093664 (IL2)
   04151 PI3K-Akt signaling pathway
    105093664 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105093664 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    105093664 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105093664 (IL2)
   04660 T cell receptor signaling pathway
    105093664 (IL2)
   04658 Th1 and Th2 cell differentiation
    105093664 (IL2)
   04659 Th17 cell differentiation
    105093664 (IL2)
   04672 Intestinal immune network for IgA production
    105093664 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093664 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    105093664 (IL2)
   05321 Inflammatory bowel disease
    105093664 (IL2)
   05330 Allograft rejection
    105093664 (IL2)
   05332 Graft-versus-host disease
    105093664 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105093664 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105093664 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105093664 (IL2)
   05162 Measles
    105093664 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    105093664 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105093664 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105093664 (IL2)
Cytokines and growth factors [BR:cdk04052]
 Cytokines
  Interleukins
   105093664 (IL2)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Haparin
  Cytokines
   105093664 (IL2)
SSDB
Motif
Pfam: IL2 Baculo_PEP_C
Other DBs
NCBI-GeneID: 105093664
NCBI-ProteinID: NP_001290477
UniProt: D7REK6
LinkDB
AA seq 154 aa
MYKLQFLSCIALTLALVANSAPTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRML
TFKFYMPKKATELKHLQCLMEELKPLEDVLNLAQSKNSHLTNIKDSMNNINLTVSELKGS
ETGFTCEYDDETVTVVEFLNKWITFCQSIYSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagctgcaattcttgtcttgcattgcactaactcttgcactcgtagcaaacagt
gcacctactttgagctctacgaaggacacaaagaaacaactggagccactgttgctggat
ttacagtttcttttgaaggaagttaataactatgagaacctcaaactctccaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacaccttcagtgtctcatg
gaagaactcaaacctttggaggatgtgttaaatttagctcaaagcaaaaactctcacctg
acaaatatcaaggactcaatgaacaatatcaatttaacggtttcggaactgaagggatct
gaaacaggattcacatgtgaatatgatgatgagacagtaactgttgtagaatttctgaac
aaatggattaccttttgccaaagtatctactcaacactgacttga

DBGET integrated database retrieval system