KEGG   Camelus dromedarius (Arabian camel): 105093713Help
Entry
105093713         CDS       T04642                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105093713 (GPD2)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105093713 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_5 EF-hand_9 NAD_binding_8 HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105093713
NCBI-ProteinID: XP_010983916
LinkDB All DBs
Position
Un
AA seq 724 aa AA seqDB search
MAFQKAVKGTILVGGGAVATVLGLSQFAHYRRKQVNLAFVEAADYVSEPVNREPPSREAQ
ILTLKNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRLVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDRLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPXERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKMDDK
NAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTDVTH
HPVPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVD
ISESGLITIAGGKWTTYRSMAEDTINAAVKTHDLKAGPSRTVGLFLQGGKDWSPTLYIRL
VQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGVKE
YACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGKELHWDDSKKKEELETARKFLYYEM
GYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMDENT
LHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRS
CGGL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggactattcttgttggaggaggtgctgttgcaact
gttctaggcctctctcagtttgctcattacagaaggaagcaagtgaacctggcctttgtt
gaagcagcagattacgtgtcagaacctgttaacagggagcctccttccagagaagctcag
atactgactttgaaaaacacatctgaattcgacatccttgtcattggaggaggagcaaca
ggaagtggctgtgccctagacgcggtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtacaggttggtaaaagaagcc
cttcatgagcgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccaatttacaagtggtggcagttaccttactactgggtaggaatcaagctatat
gacctggttgctggaagtaattgcctgaaaagcagttacgtcctcagcaaatcaagagcc
cttgagcatttcccaatgctccagaaggacagactggtaggagcaattgtctactatgat
ggacaacacaacgacgcacggatgaaccttgccattgctctcactgctgccaggtatggg
gctgccacggccaattacatggaggtagtgagcttgctcaagaagacagacccannagag
cgcgtgagcggggcgcggtgcaaggatgtcctcacagggcaggaatttgacgtgagagcc
aagtgtgttatcaatgccacgggacctttcacagacaccgtgcgcaaaatggatgataag
aacgctgcagctatctgccagccgagcgctggcgtccacatcgtgatgcctggttattac
agcccagagagcatgggacttcttgacccagcgaccagtgatgggcgagtgattttcttc
ttaccatggcaaaagatgactatagctggcactactgatactccaaccgacgttacacat
caccccgttccttctgaggaagacatcaacttcattttgaatgaagtgcgtaactacttg
agctgtgatgttgaagtgagaagaggggacgtcctggcagcgtggagcggtattcgcccc
cttgttacagatcccaagtctgcagatactcagtccatctcccgaaatcacgtagtggat
atcagtgagagcggcctcatcacgatagcaggtggaaagtggaccacctatagatctatg
gcagaagataccataaatgctgccgttaagacccacgatttgaaagcaggaccaagtaga
actgttgggcttttccttcaagggggcaaagactggagccccacactctacatcagactt
gtccaggattatggacttgaaagtgaggtggcgcagcatcttgccgccacctatggtgac
aaggcttttgaggtggccaagatggcaagcgtgacaggaaaacggtggcccattgttgga
gtgcgtctagtgtcggaatttccatacattgaagcagaggtgaaatatggggttaaggag
tatgcctgcaccgcagtagacatgatttcacgccgcactcgcctggcctttctgaatgtc
caggcagccgaggaagccctgcccaggattgttgaactgatgggcaaagaactgcactgg
gacgattctaaaaaaaaggaagaacttgaaacagccaggaagtttctctactatgaaatg
ggctataaatctcgatcagaacagttaacagatcgctctgagattagcctactgccttca
gacattgacaggtacaagaagagatttcataagtttgatgcagaccagaagggctttatc
accattgttgacgttcagcgtgtattagagagtatcggtgtccaaatggatgaaaataca
ctacatgaaattctgaatgaagtagatttgaacaaaaatggccaggttgaactcaatgaa
tttttgcagctgatgagtgctattcaaaaaggaagggtgtctggaagccggcttgctata
ctaatgaaaactgcagaagagaatctcgacagaagagttcccatccccgtggaccgaagt
tgtggaggactgtga

DBGET integrated database retrieval system