KEGG   Camelus dromedarius (Arabian camel): 105094214Help
Entry
105094214         CDS       T04642                                 

Gene name
OLR1
Definition
(RefSeq) oxidized low-density lipoprotein receptor 1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105094214 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105094214 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105094214 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:cdk04054]
    105094214 (OLR1)
   04091 Lectins [BR:cdk04091]
    105094214 (OLR1)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    105094214 (OLR1)
Pattern recognition receptors [BR:cdk04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   105094214 (OLR1)
Lectins [BR:cdk04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   105094214 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Ly49 UL45 UPF0242 FAM176 HemX TMEM223 FapA DUF4446 TALPID3
Motif
Other DBs
NCBI-GeneID: 105094214
NCBI-ProteinID: XP_010984492
LinkDB All DBs
Position
34
AA seq 274 aa AA seqDB search
MTFEDLKSKTMKDQPDQKPNGEKAKGLHYLSSRRWRPVALTLGTLCLGLLVTVIMLIIQL
SQVSDLLKQQQANLTHQEDILEGQISAQRQAEKFSEESQKELREMVEILAHKLDEKSKKL
TELQQRKMNLQEALKQAANFSGPCPQHWLWHEENCYRFSSGPFNWEKSQENCLSLDARLL
KINNTGDLEFIQQATAHSSFPFWIGLSLRKPSNSWFWEDGSPLMPHLFRIQGAFSQMYPS
GTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgaagacctcaagagcaagaccatgaaggatcaacctgatcagaagccaaat
ggagaaaaagctaaaggtcttcattatctttcctctcggaggtggcgccctgtggctttg
actctggggaccctgtgcctggggttactggtgaccgttataatgctgataatacaacta
tcccaggtgtctgatctcctaaagcaacagcaagcaaaccttactcaccaggaagatatc
ctggagggacagatttcagcccagcgccaggcagaaaaattctccgaggagtcacagaag
gagctcagagaaatggtagaaatccttgcccataagctggatgaaaaatccaagaaacta
acggaacttcaacaacggaaaatgaatctccaagaagctctaaaacaggcagcaaacttt
tcaggtccttgtccccagcactggctctggcacgaagaaaactgttaccgattttcctct
ggcccatttaattgggaaaaaagtcaggagaactgcttgtctttggacgcccggttgctg
aagattaataacacaggtgatctggaattcatccagcaagcaaccgcccattccagtttc
ccgttctggatagggctgtcactgaggaaacccagcaactcgtggttctgggaggacggc
tctcctctgatgccccacttgtttagaatccagggagctttttcccagatgtatccttca
ggcacctgtgcatatatacaaaggggaactgtttttgctgaaaactgcatattaactgca
ttcagcatatgtcagaagaaggcgaatctattgagagcacagtga

DBGET integrated database retrieval system