KEGG   Camelus dromedarius (Arabian camel): 105094245
Entry
105094245         CDS       T04642                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04151  PI3K-Akt signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04934  Cushing syndrome
cdk05162  Measles
cdk05165  Human papillomavirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105094245 (CDKN1B)
   04066 HIF-1 signaling pathway
    105094245 (CDKN1B)
   04068 FoxO signaling pathway
    105094245 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    105094245 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105094245 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094245 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    105094245 (CDKN1B)
   05206 MicroRNAs in cancer
    105094245 (CDKN1B)
   05203 Viral carcinogenesis
    105094245 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    105094245 (CDKN1B)
   05220 Chronic myeloid leukemia
    105094245 (CDKN1B)
   05215 Prostate cancer
    105094245 (CDKN1B)
   05222 Small cell lung cancer
    105094245 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105094245 (CDKN1B)
   04934 Cushing syndrome
    105094245 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    105094245 (CDKN1B)
   05169 Epstein-Barr virus infection
    105094245 (CDKN1B)
   05165 Human papillomavirus infection
    105094245 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105094245 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105094245
NCBI-ProteinID: XP_010984539
LinkDB
Position
34
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEANQLKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRSEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggatgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaagccaaccagctcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tcccaggccaactcagaggacacgcatttggtagaccaaaagactgatgcaccggacagc
cagacgggcttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagccaacagatcagaagaaaacgtttcagacggttcccccaac
gcgggttcagtggagcagacgcccaagaagcccggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system