KEGG   Camelus dromedarius (Arabian camel): 105094532Help
Entry
105094532         CDS       T04642                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00561  Glycerolipid metabolism
cdk03320  PPAR signaling pathway
cdk04979  Cholesterol metabolism
cdk05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    105094532 (LPL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105094532 (LPL)
  09154 Digestive system
   04979 Cholesterol metabolism
    105094532 (LPL)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105094532 (LPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105094532 (LPL)
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105094532 (LPL)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cdk00537]
    105094532 (LPL)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     105094532 (LPL)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   105094532 (LPL)
  Exosomal proteins of breast milk
   105094532 (LPL)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Haparin
  Enzymes
   105094532 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cdk00537]
 Enzymes
  105094532 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1 NAGLU
Motif
Other DBs
NCBI-GeneID: 105094532
NCBI-ProteinID: XP_010984884
LinkDB All DBs
Position
31
AA seq 478 aa AA seqDB search
MESKALLLVALSVWLQSLTASRGGLATADRITERSDFIDIESKFALRTPEDTVEDTCHLI
PGLTESVANCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGKDVARFINWMADELNYPPDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDAYFVDVLHTFTRGSPGRSIGIQKPVGHIDIYPNGG
AFQPGCNIGEAIRVIAERGFGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSREAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRAEMPYRVFHYQVKIHFSGTESVTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWISDSYFSW
SDWWSTPSFPVEKIRVKAGETQKKVIFCSREKMPHLRRGKSPVIFVKCHDKSLNRRSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcgctgctcctggtggcgctgagcgtgtggcttcagagtctgaccgcc
tcccgcggagggctggccaccgccgacagaattacggaacgaagtgattttatagacatc
gaaagtaaatttgctctgaggacccctgaagacacggttgaggacacttgccacctcatc
ccgggactgacagagtctgtggctaattgtcacttcaatcatagcagcaaaacctttatg
gtgatccacggctggacggtgacaggaatgtatgagagttgggtgcccaagcttgtggct
gccctgtacaagagggaaccggactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattacccggtgtctgcggggtacaccaagctggtgggaaaggacgtggccagg
tttatcaactggatggcggatgaacttaactatcctccggacaacgtccacctcttgggg
tacagccttggagcccatgctgctggcattgcgggaagtctgaccaataagaaggtcaac
agaattaccggcctggacccagctggacccaacttcgagtacgcggaggctccgagtcgg
ctttctccggatgatgcgtactttgtggacgtcctacacacgttcaccagggggtcaccc
ggccgaagcattgggatccagaaaccagtcgggcacattgacatttaccctaacggaggc
gctttccagccggggtgcaacatcggggaagctatccgtgtgatcgccgagagaggtttt
ggagatgtggaccagctagtgaagtgctcccatgagcgttccatccatctcttcatcgac
tctctgctgaacgaggaaaacccaagcaaggcctaccggtgcaattcgagggaggccttt
gagaaggggctctgcctgagctgcagaaagaaccgttgcaacaacctgggctacgagatc
aacaaggtcagagccaaaagaagcagcaaaatgtacctgaagacgcgcgcggagatgccc
tacagagtcttccattaccaagtaaagatacatttttctgggaccgagagtgttacctac
accaaccaggccttcgagatctctctgtacggcaccgtggccgagagcgagaacatcccc
ttcaccctgcctgaagtttctacaaataagacgtactcttttctaatttacacggaggtg
gatattggagagctgctcatgttgaaactcaaatggattagtgactcatacttcagctgg
tcagactggtggagcacccccagctttcctgtcgagaagatcagagtaaaggcaggagag
acccaaaagaaggtgatcttctgctccagggagaaaatgcctcatctgcggagaggaaag
tcacctgtgatatttgtaaaatgccacgacaagtctctgaacagaaggtctggctga

DBGET integrated database retrieval system