KEGG   Camelus dromedarius (Arabian camel): 105094866
Entry
105094866         CDS       T04642                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04640  Hematopoietic cell lineage
cdk04916  Melanogenesis
cdk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105094866 (KITLG)
   04014 Ras signaling pathway
    105094866 (KITLG)
   04015 Rap1 signaling pathway
    105094866 (KITLG)
   04072 Phospholipase D signaling pathway
    105094866 (KITLG)
   04151 PI3K-Akt signaling pathway
    105094866 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105094866 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    105094866 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105094866 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105094866 (KITLG)
Cytokines and growth factors [BR:cdk04052]
 Growth factors
  Growth factors (RTK binding)
   105094866 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 105094866
NCBI-ProteinID: XP_010985257
LinkDB
Position
12
AA seq 274 aa
MKKTQTWIITCIYLQLFLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVAQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNRSIDAFKDLEMAASKTSECVISSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIDDSNLQWAAMALPAFFSLIIGFAFGALYWKK
KQPNLTRAVENIQMNEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgttcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtaactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaggactataaaataaccctcaaatatgtccccggg
atggacgttttgcctagtcactgttggataagcgagatggtggcacagttgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggctgtttactcctgaaaaattc
tttggaatttttaatagatccattgatgccttcaaggatttggagatggcggcatctaaa
actagtgaatgtgtgatttcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctccaattccattgatgactccaacctacaatgggcagccatggca
ttgccagcattcttttctctcataattgggtttgcttttggagccttatactggaagaag
aaacaacccaatctgacaagggcagttgaaaatatacagatgaatgaagaggataatgag
ataagtatgttgcaggaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system