KEGG   Camelus dromedarius (Arabian camel): 105095004Help
Entry
105095004         CDS       T04642                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00480  Glutathione metabolism
cdk00980  Metabolism of xenobiotics by cytochrome P450
cdk00982  Drug metabolism - cytochrome P450
cdk00983  Drug metabolism - other enzymes
cdk01100  Metabolic pathways
cdk01524  Platinum drug resistance
cdk05200  Pathways in cancer
cdk05204  Chemical carcinogenesis
cdk05225  Hepatocellular carcinoma
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105095004 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105095004 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    105095004 (GSTO1)
   00983 Drug metabolism - other enzymes
    105095004 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105095004 (GSTO1)
   05204 Chemical carcinogenesis
    105095004 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105095004 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105095004 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105095004 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105095004 (GSTO1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105095004 (GSTO1)
Transporters [BR:cdk02000]
 Other Transporters
  Pores ion channels [TC:1]
   105095004 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 105095004
NCBI-ProteinID: XP_010985415
LinkDB All DBs
Position
Un
AA seq 240 aa AA seqDB search
MSRPSARSLGKGSAPPGPVPVGLIRVYSMRFCPFAQRTLLVLKAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLENSRGQVICESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELF
SKVPPLVKDSVRWQKKENISGLEELRKEFSKLDEVLANKETTFFGGNSPSLIDYLIWPWF
ERLEAMELNECIDHTANLKLWMAAMMKDPAVASLYIEPSTHQQFFRLYLQDSPEACDCGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaccatcagccaggagcctggggaagggaagcgcgcccccagggccggtcccc
gtgggcctgatccgcgtctacagtatgagattctgcccttttgcccagaggacactcctg
gtcctgaaggccaagggaattcggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttcttcaagaagaatccccttggtctggtgccggttctggaaaacagtcggggt
caagtgatctgcgaatctgccatcacctgcgagtacctggatgaagcatatccggggaag
aagctgttgccagatgacccctatgagaaagcttgccaaaagatggtctttgagttgttt
tctaaggtaccacctttggtaaaagactctgttagatggcaaaagaaggaaaacatctct
ggcttagaagaactgcgtaaagaattcagcaagctagatgaggtcctggccaataaggag
acaaccttctttggtggtaattctccttctctgattgattacctcatctggccctggttt
gaacggctggaagccatggagttaaatgagtgtattgaccacactgcaaatcttaagctc
tggatggcagccatgatgaaagatcctgcagtagcatcactttacattgaaccgagcacc
catcaacaatttttccgcctctacttgcaggacagccctgaggcctgtgactgtgggctc
tga

DBGET integrated database retrieval system