KEGG   Camelus dromedarius (Arabian camel): 105095719
Entry
105095719         CDS       T04642                                 

Definition
(RefSeq) whey acidic protein
  KO
K17106  whey acidic protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    105095719
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 105095719
NCBI-ProteinID: XP_010986200
LinkDB
Position
7
AA seq 160 aa
MRCLASLALALLSLEAAFALAPALSLPGQAVCPELSSSEDNACIISCVNDESCPQGTKCC
ARSPCSRSCTVPLMEPVLKDGRCPWVQTPLTAKHCLEKNDCSRDDQCEGNKKCCFSSCAM
RCLDPVTGKRLRDPSPRPPSQPPPFFLPLPAPTVVASARL
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcgctgtcttgccagcctggccctggccctgctctccctggaggctgcctttgcactg
gccccagccctctccttgccagggcaggccgtgtgcccagagctcagctcctccgaggac
aacgcctgcataatctcctgtgtcaacgatgagagctgtccccaaggcaccaagtgctgc
gccaggagcccctgcagccgatcctgcacggtccccctcatggagcctgtcctgaaggat
ggccgctgcccctgggtgcagaccccgctgaccgcaaagcactgtttggagaaaaacgat
tgctccagggacgaccagtgtgagggcaacaagaaatgctgcttcagttcgtgtgccatg
aggtgtctggaccccgtcacaggcaagcgtctcagagacccttctcctaggccaccttcc
cagccaccacccttctttctccctttgcctgcaccgaccgtggtggcctctgcaaggctc
taa

DBGET integrated database retrieval system