KEGG   Camelus dromedarius (Arabian camel): 105096090
Entry
105096090         CDS       T04642                                 

Definition
(RefSeq) sterol 26-hydroxylase, mitochondrial
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00120  Primary bile acid biosynthesis
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
cdk04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    105096090
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105096090
  09154 Digestive system
   04979 Cholesterol metabolism
    105096090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105096090
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     105096090
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP27 family
   105096090
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105096090
NCBI-ProteinID: XP_010986642
LinkDB
Position
5
AA seq 537 aa
MNSMRALGCARLRWALLGRRVALPGLGPHGARAKAAIPAALPAAQAAEAPGTGPGNRRLR
SLEELSGPGHLRLLFQLFVRGYVLQMHQLQVLNKAKYGPIWANRLGPQIHVHLASAPLLE
QVMRQEGKYPIRNDMELWKEHRDQQGLTYGPFTTEGHQWYRLRQALNQRMLKPADAALYA
NALNEVIEDFMVRLNQLRAESASGDHVPDIAHHFYFFALEAISYILFEKRIGCLERSIPQ
DTVGFVRSVGYMFQNSLYATFLPKWTRSLLPFWKRYLDGWNTIFSFGRKLIDQKVKEIEA
QLQTGVPEETRISGYLHSLLTSGQLSPGEAEGSLPELLMAGVDTTSNTLTWALYHLSKNP
EIQAALHEEVVSVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPVNSRVIVDKEIEVG
GFLFPKNTQFVFCHYVVSRDPSIFPEPDSFQPQRWLRKNQPDALRVQHPFGSVPFGYGVR
GCLGRRIAELEMQLLLTRLIQQYEVALAPETGEVTSVARIVLVPNKKVGLRFLQRQS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaatagtatgcgtgcgctaggctgtgcgaggctgcggtgggcgctgctggggaggagg
gtggccctccctggcctcggcccacacggagccagagccaaggccgcgatccctgccgcc
cttccggcggcccaggcagcggaggctcctggaaccgggcctggcaaccgaagactgcgg
agcctggaggagctttcagggccagggcatctgcgcctcttattccagctgttcgtgcga
ggctacgttctgcaaatgcatcagctccaggtgctgaacaaggcgaagtatggtccaata
tgggcaaaccgcttagggcctcagatccatgtgcacctggccagtgccccactcctggag
caagtgatgcgccaagagggcaagtacccaatacggaatgacatggaactatggaaggag
caccgggaccagcagggcctgacctatgggcccttcaccacggaaggacatcagtggtac
cggctgcgccaggctctgaaccagcggatgctaaagccagctgatgctgcactttatgcg
aatgctctgaatgaggtgatcgaggacttcatggttcgactgaaccagctgagggcggag
agcgcctcgggggaccacgtgcccgacatagctcaccatttctacttctttgctttggaa
gctatttcctacatcctgtttgagaagcgtattggctgcctggagcgctccatcccccag
gacaccgtgggctttgtcagatctgtcgggtacatgttccagaactcactctacgccacc
ttcctccccaagtggacccgttccctgttgcctttctggaagcgatacctggatggctgg
aacaccatcttctcttttgggaggaagctgattgatcagaaagtcaaggagatagaagcc
cagctgcagacaggggtcccagaggagacccggatatctggctacctgcactccctgctg
accagtggacagctcagtcctggtgaggccgagggtagcctgcctgagctgctcatggct
ggagtagacacgacatccaacactctgacatgggccctgtaccatctttcaaagaaccca
gagatccaggcagccttgcatgaggaagtggtgagcgtggtacctgccgggcaggtgccg
cagcacaaggactttgcccacatgcccctgctcaaagctgtgcttaaggagaccctgcgc
ctctaccccgtggtcccagtgaactcgcgggtcatcgtggacaaggaaatagaagttggt
ggcttcctcttccccaagaacacccagtttgtgttctgccactatgtggtgtcccgggac
cctagcatcttccctgagccggacagcttccagccccaacgttggctgaggaagaaccag
cctgatgccctcagggtccaacacccatttggctctgtgccctttggctatggggtccga
ggttgtctgggccgcaggattgcagagctggagatgcagctgctgctgacaaggctgatc
cagcagtatgaggtagccctggcccctgagacaggggaggtgacgagtgtggctcgcatc
gtcctggttcctaataagaaggtgggcctgcgtttcctgcagagacagagctga

DBGET integrated database retrieval system