KEGG   Camelus dromedarius (Arabian camel): 105096092Help
Entry
105096092         CDS       T04642                                 

Gene name
TCL1B
Definition
(RefSeq) T-cell leukemia/lymphoma protein 1B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105096092 (TCL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 105096092
NCBI-ProteinID: XP_010986647
LinkDB All DBs
Position
6
AA seq 130 aa AA seqDB search
MAEASPPVGSPPRCLWYRRPGIYEDDKGRTWVMAVLHVSPSHRAWGRGFPGSTFLQREAG
ITVHMLQMAVHPQMLRSQTRAFVSGLPLKWELYPGRKYQGTDSRLWDIVDHGQINSTERL
ILTYSSTGDD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcttctccgcccgttgggtcgcctccacgctgcctgtggtaccggaggcct
ggcatctacgaggatgacaaggggaggacctgggtgatggcggtcttgcatgtcagtccc
tcccaccgagcttggggcaggggcttccccggcagcacattccttcagcgtgaagccggc
atcacagtccacatgttgcagatggcggtgcaccctcagatgcttaggtcccagacccgt
gcgtttgtgtccgggttgcccctcaaatgggagctctaccctgggcggaagtaccaagga
acagattccagactctgggacatagtggaccatggccagatcaactccacggagcggctg
atcctaacatattcgtcgacaggggacgactga

DBGET integrated database retrieval system