KEGG   Camelus dromedarius (Arabian camel): 105096445
Entry
105096445         CDS       T04642                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04110  Cell cycle
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04310  Wnt signaling pathway
cdk04350  TGF-beta signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04630  JAK-STAT signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05132  Salmonella infection
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05216  Thyroid cancer
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105096445 (MYC)
   04012 ErbB signaling pathway
    105096445 (MYC)
   04310 Wnt signaling pathway
    105096445 (MYC)
   04350 TGF-beta signaling pathway
    105096445 (MYC)
   04390 Hippo signaling pathway
    105096445 (MYC)
   04630 JAK-STAT signaling pathway
    105096445 (MYC)
   04151 PI3K-Akt signaling pathway
    105096445 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105096445 (MYC)
   04218 Cellular senescence
    105096445 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105096445 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105096445 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105096445 (MYC)
   05202 Transcriptional misregulation in cancer
    105096445 (MYC)
   05206 MicroRNAs in cancer
    105096445 (MYC)
   05205 Proteoglycans in cancer
    105096445 (MYC)
   05230 Central carbon metabolism in cancer
    105096445 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105096445 (MYC)
   05225 Hepatocellular carcinoma
    105096445 (MYC)
   05226 Gastric cancer
    105096445 (MYC)
   05216 Thyroid cancer
    105096445 (MYC)
   05221 Acute myeloid leukemia
    105096445 (MYC)
   05220 Chronic myeloid leukemia
    105096445 (MYC)
   05219 Bladder cancer
    105096445 (MYC)
   05213 Endometrial cancer
    105096445 (MYC)
   05224 Breast cancer
    105096445 (MYC)
   05222 Small cell lung cancer
    105096445 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105096445 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105096445 (MYC)
   05161 Hepatitis B
    105096445 (MYC)
   05160 Hepatitis C
    105096445 (MYC)
   05163 Human cytomegalovirus infection
    105096445 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105096445 (MYC)
   05169 Epstein-Barr virus infection
    105096445 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105096445 (MYC)
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105096445 (MYC)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    105096445 (MYC)
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     105096445 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 105096445
NCBI-ProteinID: XP_010987087
LinkDB
Position
25
AA seq 438 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGFSTADQLEMVTELLGGDMVNQSFICDPDD
ETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSSSPSPARGHGGCSTSSLYLQDL
SAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLALH
EETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDYPAAKRAKLDNGRVLKQISNNRKCASPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDVLR
KRREQLKLKLEQLRNSCA
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccctcaatgtcagcttcaccaacaggaactatgacctcgactatgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccaagccgccgctccgggctctgctctccctcctacgttgcggtcgcgtccttc
tcccccaggggagacgacgacggcggcggcggcttttccactgctgaccagttggagatg
gtgaccgagctgctgggaggagatatggtgaaccagagcttcatatgcgacccggacgac
gagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggccgcc
gccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcagcagc
ccgagccccgcccgtgggcacggcggctgctccacctccagcctgtacctgcaggaccta
agcgccgccgcctccgaatgcatcgacccctccgtggtcttcccctacccgctcaacgac
agcagttcgcccaagccctgcgcctccccggactccaccgccttctccccgtcctcggac
tctctgctctcctccgccgagtcgtccccgcgggccagtcccgagcccctggcgctccac
gaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaagaa
attgatgttgtttctgtagagaagaggcagccccctgccaaaaggtcggaatcggggtca
ccttctgccggaggccacagcaaacctcctcacagcccattggtccttaagagatgccat
gtgtccacccatcagcacaattatgcagcaccaccctccaccaggaaggactatcctgct
gccaagagggctaagttggacaatggcagggtcctgaaacagatcagcaacaacagaaaa
tgtgccagccccaggtcttcggacacggaggagaatgacaagaggcggacacacaacgtc
ttggagcgccagaggaggaacgagctgaaacgcagcttttttgcccttcgtgaccagatc
ccggagttggagaacaatgaaaaagcccccaaggtagttatccttaaaaaagccacagcc
tacatcttgtccatccaagcagaggagcaaaagctcatttcagaaaaagacgtgttgcgg
aagaggcgagaacagttgaaactcaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system