KEGG   Camelus dromedarius (Arabian camel): 105096603Help
Entry
105096603         CDS       T04642                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01524  Platinum drug resistance
cdk03440  Homologous recombination
cdk04064  NF-kappa B signaling pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04115  p53 signaling pathway
cdk04210  Apoptosis
cdk04218  Cellular senescence
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05202  Transcriptional misregulation in cancer
cdk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    105096603 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    105096603 (ATM)
   04068 FoxO signaling pathway
    105096603 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105096603 (ATM)
   04210 Apoptosis
    105096603 (ATM)
   04115 p53 signaling pathway
    105096603 (ATM)
   04218 Cellular senescence
    105096603 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105096603 (ATM)
   05206 MicroRNAs in cancer
    105096603 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105096603 (ATM)
   05170 Human immunodeficiency virus 1 infection
    105096603 (ATM)
   05165 Human papillomavirus infection
    105096603 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105096603 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105096603 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105096603 (ATM)
   03400 DNA repair and recombination proteins [BR:cdk03400]
    105096603 (ATM)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105096603 (ATM)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   105096603 (ATM)
DNA replication proteins [BR:cdk03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     105096603 (ATM)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    105096603 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC RYDR_ITPR Uso1_p115_head
Motif
Other DBs
NCBI-GeneID: 105096603
NCBI-ProteinID: XP_010987273
LinkDB All DBs
Position
Un
AA seq 3058 aa AA seqDB search
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIQDPETIQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLKTAKPNVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNRAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFELYLKPSQ
DINRVLVARIIQAVTKGCCSQTDKLDRKFLNWDFFPKAIQQARQEKSSAGLNHILEAFVI
FLKTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGARTQ
ETGAYESRKWRSILYNLYDLLVNEISHIGSRGKYSSGARNIAVKENLIELMADVCHQVFN
EGTRSLEIFQSYTTTQREFSDCSAPCKKKKIELGWDVIKDHLQKSQNDFDLVPWLQIAAQ
LISKYPASFPSCELSPLLVILCQLLPQQRRGERTPYVSRCLMEVALCQGKKSDLESSQKS
DLLKLWIKIWSITLRGISSEQIQAENFGLLGAIIQGNLVEVDREFWKLFTGSACKPSRSA
VCCLTLALTTCVVPETVKTGMEKSICDVNRNFSLKELIMKWLLFCQLEEDFEDSTELPPI
LHSDFPHLALEKILVSLTMKNCKDAMNFFQSVPECEQHEKSTEEPSFSEAEELFLQTTFD
KMDFLTIVEEHSIEKHQSSVGFSVHQNLKESLDRCLLGLSQQLLNNYSSETSNSEALVRC
SRLLVGVLGCYCYVGVIAEEEAYASELFQKAKSLMQCAGESITLFKNKTNEEFRIVQLRN
MMHLCTSCLYNCAKGSPNKIASGFFLRLLTSKLMNDIADICRSLASIIKKPLDLGEVESV
DNDTHENLMEMEDQSSMSLFNDHPASNVTDANESGESQLTIGATNPLAEEHLSKQDLLVL
DMLKFLCMCVTTAQTNTVSFRAADIRRKLLMLIDSSMLDPTRSLHLHMYLVLLKELPGEE
HPLPMEDVVELLKPLSNVCSLYRRDQDVCKTILNHVLRIVTNLCQGDTDTENTSDAQGQF
LTVIGAFWHLAKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMKEDFPVNEIFPQFL
ADSHHQVCMLAAESVNRLFQHMEQGHSSTLLKALPLKLQQTAFENAYLKAQEGMREVSHR
AENPEFLDEICNRKAILLMMIAVVLCCSPVCEKQALFALCKSVKENGLEPHLIKKVLEKV
SETFGYRHLEDFMASHLDYLVLEWLNLQYSLSSFPFILLNYTNIEDFYRSCYKVLIPHLV
IRSHFDEVKSIANQIQEDWKHLLTDCFPKILVNILPYFAYEGTGDSGMAQQRETATKVYD
MLKDENLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPPH
FPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICVQAAETNNVYKKHRILK
IYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINKRPARFTGVSLRSFSLCCDLLSR
VCHTAVTHCKDALENHLHVIVGTLIPLVDDQMEVQKQVLDLLKYLVIDNKDNENLYITIK
LLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRRQ
LEQHKDQMMDLMRASQDNPQDGMMVKLVVGLLQLSKMAANHTGEKEVLEAVGSCLGEVGP
VDFSTIAIQHNRDTSCTKALELFEDKELQWTFIMLTYLNSTLIEDCVKVRSAAVTCLKSI
LATKTGHSFWEIYKTTTDPMLTYLQPFRTSRKKFLEVPRLEKESPLEGLDDTNLWIPQSE
NHDIWIKTLTCAFLDSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWRN
LLSTHIQGFFTYCFRQSSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYLRRQK
RPSSGTVFEDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNMDDQERRNLTFEEG
SQSTTISCLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHEA
MWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKRLDHENKEWCAELQELHY
QAAWRGMQWDHCVSVNKRIEGTSYHESLYNALQALRDREFSTFYESLKYARVKEVEELCK
GSLESVYSLYPTLSRLQAIGELEDIGELLSRSVMDRQPSEVYSKWWKHSQLLKDSDFSFQ
EPIMALRTVILEILIEKEVENSQRECFKDILTKHLVELSTLARTFKNTQLPERAIFQIKQ
YNPASCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASYLEMQNDPNLKLIYTECL
RVCGTWLAETCLENPAVIMQTYLEKAVEVAGSYEGESNDGLRNGKMKAFLSLARFSDTQY
QRIENYMKSSEFENKQALLRRAKEEVGLLREHKIQTNRYTVKVQRELELDECALHALKED
RKRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKFLP
LMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAA
RRSRIPKNTPKQSSQLDEDRIEAANKIIRTIRSRRPQMVRSVEALCDAYIILANLDATQW
KTQRRGISIPADQPITKLKNLEDVVVPTMEIKVDPTGEYRNLVTIQSFKAEFRLAGGLNL
PKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVV
PLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSALQCQKKMMEVQKKSFEDKYE
TFMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILI
NEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVM
RNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESEFHSTLNAEDQECKRTRSDT
DQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKPWV
NT seq 9177 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaagaggttgagaaatttaagcgcctgattcaggatcctgaaaccatt
caacatttagatcggcattcagattccaaacaaggcaaatacttgaattgggatgctgtt
tttagatttttacagaagtatattcagaaagaaacagaatgtttgaaaacagcaaaacca
aatgtatcagcctcgacacaagccaccaggcagaaaaagatgcaagaaatcagtagcttg
gtcaaatacttcatcaaatgtgcaaataaaagagcaccccgactaaaatgtcaagaactc
ttgaattatatcatggatacagtgaaggattcatctaatagagccatttatggggccgat
tgcagcaacatattgctgaaggacattctttcagtaaggaaatactggtgtgaaatatct
cagcaacagtggctagaattattctctgtgtactttgagctgtatcttaaaccttcacag
gacattaatagagttttggtggctagaataattcaagctgtgaccaaaggatgctgttca
cagactgataaattagatcgtaaatttctgaattgggatttttttcctaaggctattcag
caagcaagacaagaaaagagctctgcaggcctaaatcatatcttagaagcgtttgttatc
ttcctcaagactttggctgttaactttcgaattcgcgtgtgtgaattaggagatgaaatt
ctccctactttgctttatatttggactcagcatagacttaatgattccttaaaagaagta
attattgaattatttcaactacaaatttatatccatcatccaaagggagccagaactcaa
gaaacaggtgcttatgaatcaagaaaatggagaagtatcttatacaacctatatgaccta
ctagttaatgaaataagtcatataggaagcagagggaaatattcttcaggagctcgtaat
attgctgtcaaggaaaacttgattgaattgatggcagatgtttgtcaccaggtttttaat
gaaggtaccagatctctggaaatttttcagtcgtatacaaccacacaaagagaatttagt
gattgcagtgcaccttgcaaaaagaagaaaatagaattaggctgggatgtaataaaagat
catcttcagaagtcacagaatgattttgatcttgtgccttggttacagattgcagctcag
ttaatatcaaaataccctgcaagtttccctagctgtgagctgtcaccattgctagtgata
ctgtgccagcttctgcctcagcagcgacgtggggaacggacgccgtatgtgtcgcgatgc
cttatggaagttgcactgtgtcaaggcaagaaatcagacctcgaaagctctcaaaagtca
gatttattgaaactctggattaaaatttggtctattacccttcgcggtataagttctgaa
caaatacaagctgaaaactttggcttacttggagccataattcaaggtaatttagttgaa
gttgacagagaattctggaaattattcactggatcagcttgcaaaccttcacgttctgca
gtatgctgtttgactttggcgctgaccacctgtgtagtcccagaaacagtaaaaacagga
atggagaagagtatatgtgatgtaaacagaaatttttctttaaaagaattgataatgaag
tggctcttattctgtcagttagaggaagactttgaagacagtacagagctgcctccaatt
cttcacagtgattttcctcatcttgccctggagaaaattcttgtgagtctcactatgaaa
aactgtaaggatgcaatgaactttttccaaagtgtgccagaatgtgagcagcatgaaaaa
agtacagaagagccttcattctcagaagccgaagaactgtttcttcagacgacttttgac
aagatggattttttaaccattgtggaagagcatagtatagaaaagcaccaatccagtgta
gggttttctgtccaccaaaatctcaaggaatcactggatcgctgtcttctgggattatca
caacagcttctaaataactactcatctgagacttcaaattcagaagcgcttgtccggtgt
tcacgccttctggtgggtgttctcggctgctattgctatgtgggtgtgatagctgaagag
gaagcatatgcatcagaattattccagaaagccaagtctctaatgcagtgtgcaggagaa
agtatcactctgtttaaaaataagacaaatgaggagttcagaattgttcaactgagaaat
atgatgcatctgtgtacaagttgcttgtataactgtgccaagggcagtccaaataagatt
gcatctggctttttcttacgattattaacatcaaagctaatgaatgatattgcagatatt
tgtagaagtttagcatccattatcaaaaagccgttggatttgggagaagtagaatcagtg
gacaatgatactcatgaaaatctaatggagatggaggatcagtcttccatgagtctattt
aatgatcaccctgctagtaatgttactgatgcaaatgaatctggggagagccagctcact
attggtgccacgaatcctttagctgaagaacatctgtcaaagcaagatctacttgttttg
gacatgctcaagttcttgtgtatgtgtgtgaccactgctcaaaccaatactgtgtcattt
agagcagctgatattcggaggaaattgttaatgttaattgattctagcatgctagaccct
accagatctctccacctacacatgtatctagtgcttttaaaggaacttcctggagaagaa
catcccttgccaatggaagatgttgttgaacttctaaaaccactatccaatgtgtgttct
ttgtatcgccgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcgtatagtg
acgaacctgtgtcaaggagatacggacactgagaacacaagtgatgctcaaggacagttt
cttacagtgattggagcattttggcacttagcaaaggagggaaaatgcacattctctgta
agaatggcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgg
gctattctaaatgtaatgaaagaagactttcctgtaaacgaaatatttccgcagtttctt
gctgatagtcatcaccaagtttgcatgttggctgcagaatcagtcaatagattatttcag
catatggaacaaggacattcttctacattattgaaagcacttcctctgaagcttcagcaa
acagcttttgaaaatgcctacttgaaagctcaggaaggaatgagagaagtgtcccacaga
gctgagaaccctgaatttttggatgagatttgtaataggaaagccattttactgatgatg
atagctgtggtgttatgctgtagccctgtctgtgaaaaacaggctttgttcgcgctttgc
aagtctgtgaaagagaatggattagagcctcacctcattaaaaaggttttagagaaagtt
tctgaaacttttggatacagacatttagaagacttcatggcttctcacttggattatctg
gttttggaatggctaaatcttcaatacagcttatcttcttttccttttattttgttaaac
tacacaaacattgaggatttctataggtcttgttataaagttttgattccacatctggtg
attagaagtcattttgatgaggtgaagtccattgctaatcagattcaagaggattggaaa
catcttctgacagattgctttccaaagattcttgtaaatattcttccatacttcgcttat
gagggtaccggagacagtgggatggcgcagcaaagagagactgctaccaaagtctatgat
atgcttaaagatgaaaacttattaggaaaacagattgatcacttattcattagtaattta
ccagagattgtggtggagttactgatgacgttacacgaaccagcaacgtctggtgccagc
cagagcactgacccctgtgatttttcaggggatttggatcctgctcccaatccacctcat
tttccatcacatgtgattaaagcaacatttgcctatatcagtaattgccataaaacaaag
cttaaaagcattttagaaattctttccaaaagtcctgactcctatcagaaaatcctccta
gccatatgtgtgcaagcagctgagacaaacaatgtttataaaaagcacagaattcttaaa
atatatcacctgtttgttagtttattactgaaagatataaagagtggcttaggtggagct
tgggcctttgttcttcgagatgttatttatactttgattcactatatcaacaaaaggcct
gctcgtttcacgggtgtgtcattacgtagcttctccctttgttgtgacctgttaagccgg
gtttgccacacagcagtaactcactgtaaggatgctttagaaaatcatcttcatgttatc
gttggtacacttataccccttgtggatgatcagatggaggttcagaaacaggtattggac
ttgttgaaatacttagtgattgataacaaggataatgaaaacctatatatcacgattaaa
cttttagatccttttcctgaccacgttgtctttaaggatttacgtattactcagcagaaa
atcaaatacagtagaggacccttttcactcttggaggaaattaaccattttctctcagta
agtgtttatgacgcacttcccttgacacggcttgaaggactgaaggatcttcgaagacaa
ctagagcaacataaagatcagatgatggatcttatgagagcatctcaggataacccgcag
gatggcatgatggtgaagctggttgtcggcttgttgcagttatccaagatggcagcaaac
cacactggtgaaaaagaagttttagaggctgttggaagctgcttgggagaagtgggtcct
gtagatttctctacaatagcgatacaacataacagggacacgtcgtgtaccaaggctctt
gagttatttgaagataaagagcttcagtggaccttcataatgctgacctacctgaacagt
acactgatagaagattgtgtcaaagtgcgatcagcagctgttacctgtttgaaaagcatt
ttagccacaaaaactggacatagtttctgggagatttataagacgacaactgatcccatg
ctgacctatctacagccttttcgaacatcaagaaaaaagtttttagaagtacccagactt
gagaaagaaagccctttagaaggcttggatgatacaaacctgtggattcctcaaagtgaa
aatcatgacatttggataaagacactgacttgtgcttttttggatagtggaggcacaaaa
agtgaagttctgcagttattaaagccaatgtgtgaagtgaaaactgacttttgtcagact
gtgcttccatacttgattcatgatattttactgcaagatacaaatgaatcatggagaaat
ctgctttctacacatattcagggatttttcacttactgcttcagacagtcctcacaaaca
agccggtccacaacccctgcaaatttggattcagagtctgagcactttttccgatgctgt
ttggacaaaaaatcacagagaacaatgcttgctgttgtggactacttgaggagacaaaag
agaccttcctcaggaacagtttttgaagatgctttctggctggagttgaattacctagag
gttgccaaggtagctcagtcttgtgctgctcactttacagcattgctttatgcagaaatc
tatgcagataaaaagaacatggatgatcaagagagaagaaatcttacatttgaagaagga
agccaaagtacaactatttcctgtttgagtgaaaaaagtaaagaagaaactggaataagt
ttacaggatctgctcttagaaatctacagaagtataggagagccagatagtctttatggc
tgtggtggagggaaaatgttacaaccccttactagactacgaacatatgaacatgaagcg
atgtgggggaaagccctggtaacatatgaccttgagacggcaatcccctcatcaactcgc
caggcgggaataattcaggccttgcagaatttgggactctgccatattctttccgtctat
ttaaaacgattagatcatgaaaataaagagtggtgtgctgagctacaggaactgcattac
caagcagcatggaggggcatgcagtgggaccactgtgtttctgtcaacaaaaggatagaa
ggaaccagttaccacgaatcattgtacaatgctctacaggctctaagagacagagaattc
tccactttttatgaaagtctcaagtatgccagagttaaagaagtggaggagctgtgtaag
ggcagccttgagtctgtgtattccctctaccccacgctcagcagactgcaggccatcgga
gagcttgaggacatcggggagcttttgtcaagatcagtgatggataggcagccctctgaa
gtatacagtaagtggtggaaacactcccagcttctgaaagacagtgattttagttttcag
gagcctataatggctctacgcacagtcattttggagatcttgatagaaaaggaagtggag
aactcccagagagagtgttttaaggacattctcaccaagcaccttgtagaactctccaca
ctagcccgaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaacag
tataatccagctagctgtggagtctctgagtggcagctggaggaagcacaagtgttctgg
gcaaaaaaggaacagagtcttgccctgagcattctcaagcagatgatcaagaagttggat
gccagttatttagagatgcagaatgatcccaacctaaaacttatatacacggaatgtctg
agggtgtgtggcacctggttagcagaaacttgcttagaaaatcctgctgtcattatgcag
acttacctagaaaaggcagtggaagttgctggaagttatgaaggagaaagcaatgatggg
ctcagaaatggaaaaatgaaggcgtttctctcattagcacggttctcagatacccagtac
caaagaattgaaaactatatgaagtcatcagaatttgaaaacaagcaagctctcctgaga
agagccaaagaggaagtgggccttcttagggaacataaaattcagaccaacagatacacc
gtaaaggttcagcgagagctggagctggatgaatgtgcgctccatgcgttgaaagaagat
cgtaaacgtttcttatgtaaagcagttgaaaattacatcagttgcttactaagtggagag
gggcatgacatgtggatattccgtctttgttccctctggcttgaaaattctggagtttct
gaggtcaatggcatgatgaagagagatggaatgaagattccgtcatataaatttttgcct
cttatgtaccagttggctgctagaatggggaccaagatgatgggaggcctaggatttcat
gaagtcctcaataacctcatctctagaatttcaatggatcaccctcatcatactttgttt
attatactggccttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagca
agaaggagcagaatacctaaaaacacacctaaacagagctcgcagcttgacgaggatcga
attgaggctgcaaacaaaataatacgtactatcagaagtaggaggcctcagatggtcaga
agtgttgaggcactttgtgatgcttacattatattagcaaacttggatgccactcagtgg
aagacccagagaagaggcataagcattccagcagaccagcccatcactaaactgaaaaac
ttagaagacgttgttgtccctactatggaaattaaggtggaccccacaggagaatataga
aatctggtgactattcagtcatttaaagcagaatttcgtttagcaggaggtttaaattta
ccaaaaataatagattgtttgggctctgatggcaaagaaaggagacagcttgtcaagggc
cgtgatgacctgagacaagatgctgtcatgcagcaggttttccagatgtgtaatacatta
ctgcagagaaacactgaaaccaggaagaggaaactgactatctgcacgtataaggtggtt
cccctttctcagcgaagtggtgtccttgaatggtgcacaggaactgtccctattggtgaa
tttcttgttaacaatgagaatggtgctcataaaagatacaggccaaaggatttcagtgcc
cttcagtgccaaaagaaaatgatggaagtgcaaaagaagtcttttgaagacaaatacgaa
accttcatggatatttgccaaaattttcaaccagttttccgttacttctgcatggaaaaa
ttcttggatccagctgtttggtttgagaagcggttagcttatacgcggagtgtggctact
tcttctattgttggttacatacttggacttggggatagacacgtacagaacatcttgata
aacgagcagtcagccgagctcgtacatatagatttaggagttgcctttgaacagggtaaa
atccttcccactcctgaaacagttccttttaggctcaccagagatattgtggatgggatg
ggcattaccggtgttgaaggtgtctttagaagatgctgtgagaaaaccatggaggttatg
agaaactctcaggaaaccctgttaactattgtggaggtcctcctgtatgaccctctcttt
gactggaccatgaatcctctgaaagctttgtatttacagcagaggccagaagacgaaagt
gagttccactccactctgaacgcagaggaccaggaatgcaaacgaacccgcagtgatact
gaccagagtttcaacaaagtagctgaacgtgtcttgatgagactgcaagagaaactgaaa
ggagtggaggagggaaccgtgctcagcgtgggtggacaggtgaatttgctcatccagcag
gccatggaccccaaaaatctcagccggcttttcccaggatggaaaccttgggtgtga

DBGET integrated database retrieval system