KEGG   Camelus dromedarius (Arabian camel): 105096653
Entry
105096653         CDS       T04642                                 

Gene name
ACADM
Definition
(RefSeq) medium-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00280  Valine, leucine and isoleucine degradation
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
Module
cdk_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
cdk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105096653 (ACADM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105096653 (ACADM)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105096653 (ACADM)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     105096653 (ACADM)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-GeneID: 105096653
NCBI-ProteinID: XP_010987345
UniProt: A0A5N4DBX6
LinkDB
Position
13
AA seq 421 aa
MAAVFRRSCGVLRSLSRFDWRSQHTKAVLKREPGAGFSFELTEQQKEFQATARKFAREEI
LPVAAEYDKTGEYPVPIIKRAWELGLMNTHIPESCGGLGLGSFDSCLITEELAYGCTGIQ
TAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPKTPANKAFTGFIVEADTPGVQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGEGAGFKIAMGAFDKTRPSVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQGISFLLAEMAMKVELARLSCQRATWEIDSGRRNTYYASIAKAF
AGDIANQVATDAVQIFGGNGFNTEYPVEKLMRDAKIYQIYEGTAQIQRLIIAREHIGRYK
N
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcagcggtgttcaggcgaagctgcggggtactgagaagtctttctcgttttgactgg
agatcacagcatacaaaagctgtcctaaaacgtgaaccaggagcgggatttagttttgag
ttaactgaacagcagaaagaatttcaagctactgctcgtaaatttgccagggaggaaata
ctgccagttgctgcagaatatgataaaactggcgagtaccctgtcccaataattaaaaga
gcctgggaacttggtttaatgaatacacacattccagaaagttgtggaggtcttggactt
ggaagttttgatagctgtttaattactgaagagttggcttatggatgtacaggcattcag
actgccattgaaggaaattctttggggcaaatgcctattattattgctggaaatgatcaa
caaaagaagaaatatttggggaggatgactgaggagccactgatgtgtgcctactgtgta
acagaacctggagcaggctctgatgtagctggtataaagactaaagcagaaaagaaagga
gatgagtatattattaatggacagaagatgtggataaccaatggaggaaaagctaattgg
tattttttgttggctcgttctgatccggatcctaagactcctgccaataaagcctttact
ggatttattgtggaagcagataccccaggagtgcagattggaagaaaggaattaaatatg
ggtcagcgatgttcagatacaagaggaattgtctttgaagatgtgaaagtgcctaaggaa
aatgttttaattggtgagggagctggtttcaaaattgcaatgggagcttttgataaaacc
agaccttcagtggcagctggtgctgtgggactagcacagagagctttggatgaagctacc
aagtatgccctggagaggaaaacatttggaaagctgcttgtagagcaccaaggaatatca
tttttgctggctgaaatggcaatgaaagttgaactagctagactgagttgccagagagcc
acttgggagattgattctggtcgccgaaatacctattatgcctctattgcaaaggcattt
gctggagatattgcaaatcaggtagctactgatgctgtgcagatttttggaggcaatgga
tttaatacagaatatcccgtagaaaaactgatgagagatgccaagatctatcagatttat
gaaggtacagcacaaattcaaaggcttattatagcccgtgaacacattggcaggtataaa
aattaa

DBGET integrated database retrieval system