KEGG   Camelus dromedarius (Arabian camel): 105096869
Entry
105096869         CDS       T04642                                 

Gene name
SPINT1
Definition
(RefSeq) kunitz-type protease inhibitor 1 isoform X1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105096869 (SPINT1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105096869 (SPINT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105096869 (SPINT1)
Peptidases and inhibitors [BR:cdk01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   105096869 (SPINT1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a
Other DBs
NCBI-GeneID: 105096869
NCBI-ProteinID: XP_031309149
LinkDB
Position
6
AA seq 514 aa
MVPGRTMAGACLSQARTLAVAVWLLGAIGLLRTQAGPPPVPPGLLTADNCLGRFTPGVPA
FVLDTNASVRNGATFLRSLTVRRGRDCVHACCSSENCNLALVELQPDGGEDAIASCFLID
CLYEQNFVCKFAPREGFINYLRREVYRSYRELRTQGFVGSGIPKSLAGIDLKVQPQEPLM
LKSENTDWHLLQGDTDVRVERNDPDQVELWGLKEGSYVFQLTVAGSEQPESTSNVTVTVL
SAKQTEEYCLASSKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLWEEECKLACR
NVQGPSVERHHPVCSGTCHSSKFRCSDGCCIDSFLECDDTPDCPDASDEATCEKYTSDFD
KLQRIHFPRDKGHCVDLPDTGLCLESIPRWYYNPFTERCARFTYGGCYGNKNNFEEEEQC
LESCRGISKKDVFGLRRESPVPNTGSMEVAIAVLLGTCIVVVVAILGYCFFKNQRKGFHR
HGHGHPPPPTPTSSKVSTTEDMEHLVYYQTTRPL
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggtccctgggaggacgatggcgggggcctgcctctcccaagcccgcactctggcggtc
gccgtgtggcttctgggcgcaatcggcctcctgcgcacccaggccgggccaccgccggtg
ccccccggtctgcttacggcagacaactgcctgggccgctttacccccggggtgcctgcc
ttcgtgctggacaccaacgcctcggtcagaaacggggccacctttctgcgctccctcacc
gtgcgccgcggccgggactgcgtgcatgcctgctgcagctccgaaaactgcaatctggcg
ctggtggagttacagcccgacggcggggaggacgccatcgcctcctgcttcctcatcgac
tgcctctacgaacagaactttgtgtgcaagttcgcacccagggagggtttcatcaactac
ctcaggcgggaggtttatcgatcttaccgcgagctgcggacccaaggctttgtagggtcc
gggatccccaagagcttggcaggcatagacttgaaggtacagccccaggaacccctcatg
ctgaagagtgagaacacagactggcacctactgcagggtgacacagatgtccgggtagag
aggaatgacccggaccaggtggagctgtggggactcaaggaaggcagctatgtgttccag
ctgacagtggccggctcagagcagccagagagcacgtccaatgtcacagtcaccgtgctg
tccgccaagcagacagaagaatactgcctcgcatccagcaaggtgggccgctgccgaggc
tccttcccccgctggtactacgaccccacggaacagatctgcaagagttttgtctatggg
ggttgcttgggcaacaagaacaactacctttgggaagaagagtgcaagctcgcctgccgc
aatgtgcaaggcccctcagtggaaaggcaccatccagtgtgctctggcacctgtcactcc
agcaagttccgctgcagcgatggctgctgcatcgacagcttcctggagtgtgacgacact
cccgactgccccgacgcctccgacgaggccacctgtgaaaaatataccagtgactttgat
aaactccagaggatccatttccccagagacaaaggccactgcgtggacctgccagacacc
ggcctctgcttggagagcatcccacgctggtactataaccccttcactgaacgctgcgcc
cgctttacctatggcggttgttatggcaacaagaacaactttgaggaggaggagcagtgc
cttgagtcctgtcgtggcatctccaagaaggatgtgtttggtcttcggcgggaaagcccc
gttcccaacacaggctccatggaagtggccatcgcagtcctgctgggcacctgcatcgtg
gtggtggtagccatcctgggttattgcttcttcaagaaccagaggaagggcttccacaga
catggccacggccatcccccgccccctacccccaccagctccaaggtctccaccaccgag
gacatggagcacctggtctattaccaaacgacccgacccctctga

DBGET integrated database retrieval system