KEGG   Camelus dromedarius (Arabian camel): 105097331Help
Entry
105097331         CDS       T04642                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00052  Galactose metabolism
cdk00500  Starch and sucrose metabolism
cdk01100  Metabolic pathways
cdk04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105097331 (MGAM)
   00500 Starch and sucrose metabolism
    105097331 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105097331 (MGAM)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     105097331 (MGAM)
    3.2.1.20  alpha-glucosidase
     105097331 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105097331
NCBI-ProteinID: XP_010988162
LinkDB All DBs
Position
Un
AA seq 1841 aa AA seqDB search
MARKKLKRFTTLELMLSTLLLVVFLITIPLFVLSARDSLKSEDPGTAVTPDPGTTVTPDS
GMSSTPDSAECPVVNELERINCIPDQSPTKATCDQRGCCWKPQGTISVPWCYYSQSHGYR
VEGDLVKTSAGFTAQLDRLPSPSLFGSDVSNVLLTAEYQTSNRFHFKLTDQNKDRYEVPH
EHVQPFQGSAASPLTYDVEVSKQPFSIKVLRRSNSRVLFDSSIGPLLFADQFLQLSTRLP
SANVYGLGEHVHQQYRHDMNWRTWPIFARDTAPTGDGTNLYGAQTFFLCLEDASGLSFGV
FLMNSNAMEVALQPTPALTYRTIGGILDFYVFLGSTPEQVVQEYLELIGRPALPSYWALG
FHLSRYDYGTLDNMKEVVDRNRAAQLPYDVQHADIDYMDARKDFTYDPVNFKGFPEFAKE
LHSNGQKLVIIVDPAISNNSSLSSPYGPYDRGSDVKIWVNASDGVTPLIGEVWPGKTVFP
DFTNPQCTAWWTNEFELFHNQVEFNGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPRVL
DGYLFRKSLCMDAVQHWGKHYDVHSLYGYSMAIATSEAVKTVFPNKRSFILTRSTFAGSG
KFAAHWLGDNAATWSDLQWSIPAMLEFNLFGIPMVGSDICGFTLDAPEELCRRWMQLGAF
YPFSRNHNCQGYKAQDPASFGADSLLLNSSRHYLTVRYTLLPHLYTLFYQAHSRGDTVAR
PLLHEFYADSNTWDVHQQFLWGPSLLITPVLNEGAEKVTAYVPDAVWYDYETGARVRWRK
QRVEMELPGDKIGLHLRGGYIFPTQQPATTTEASRRNPLGLIIALDENKEAKGELFWDDG
ETKDTVANKAYLLCEFSVTQNRLDVKILQSTYTDPNNLVFKEIKILGTQEPTNITVKHNG
VHPSHVSPNVTYDSALQVALITGIDLVLGEAYTVEWDVKIRDAEKIDCYPDENGASAENC
AARGCVWEESSSPGVPFCYFINDLYSVGDIQYDSHGATAVISLKSSPYAYTLPSTPVSSL
RLDVTYHKDNMLQFKIYDPDNNRYEVPIPLNIPEVPSSTPESRLYEVLIKKNPFGIEVRR
KSTGTVIWDSQLLGFTFNDMFIRISTRLPSQYLYGFGETEHTAFRRDLNWNTWGMFSRDQ
PPGYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVVL
GPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDAEIASLYDDMVAAQIPYDVQYA
DIDYMERQLDFTLGPEFAGLPALITRIQADGMRVILILDPAISGNETKPYPAFTRGVEED
VFIKDPSDGSIVWGKVWPDFPNVVVNSSLDWDTQLELYRAYVAFPDFLRNSTITWWKREL
RELYTNPRNPETSLKFDGMWIDMNEPASFVNGAVPPGCKNATLNHPPYMPHLESRDKGLS
SKTLCMESQQILPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGERGIVVTRSTFPSSGR
WGGHWLGDNTAAWDQLRKSIIGMMEFSLFGIPYTGADICGFFQDAEYEMCARWMQLGAFY
PYSRNHNTIGTRRQDPVSWNATFVTLSRSVLRTRYTLLPYLYTLMHVAHVEGSTVVRPLL
HEFVADRVTWDVDGQFLLGPAFLVSPVLQPGAADVTAYFPRARWYDYYTGVDIKARGEWK
SLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFLGFKVALDDQGTAEGCLFWDDGQSI
DTYEKGLYYLANFSVSQNTMQSHVIFNKYISDTNPLKLGYVEIWGVGSDSISSVSISVSG
VVVTPSFTYDSTTQVLNIDVTSRNISLHNFTSLTWRSTLSS
NT seq 5526 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaacgtttcactactttggagcttatgctcagcacccttctg
cttgtggtgtttctcatcactattcctctgtttgtgctttcagccagagattctttgaaa
tcagaagatcctgggacggcagttactccagatcctgggacaacagttaccccagattcg
gggatgagttccacccctgattctgctgagtgcccagtggtaaacgaattggaacggata
aactgcatccccgaccagtccccaacaaaggccacatgtgaccagcgtggctgctgctgg
aaacctcagggaaccataagtgtgccctggtgctactactctcagagtcacggctatcga
gtggagggcgaccttgtgaagacaagtgcaggattcacagcccagttggacaggttgcct
tctccgtctctgtttgggagtgatgtcagcaacgtgcttctcacagcggaataccagacg
tctaaccgcttccactttaagttaactgaccaaaacaaggaccgatacgaagtgccccat
gaacatgtgcagcccttccaaggaagtgctgcttctcccttgacctatgacgtggaggtc
tccaagcagccatttagcatcaaagtgctcagaaggagcaacagtcgggtcctgtttgac
tcaagcatcgggcccctcctgtttgcggatcagttcctgcagctgtccacccgactgccc
agtgctaacgtgtacggcctgggagagcacgtgcaccagcagtaccgccatgatatgaac
tggaggacctggcccatatttgccagggacacagcccccactggggatggaactaacttg
tatggtgcacagacattcttcctgtgccttgaagatgctagtggattgtcctttggagtg
tttctgatgaacagcaatgccatggaggtcgccctccagcctaccccagctctcacttac
cgtaccattgggggcattctcgacttctatgtgttcttgggaagcactccagagcaagtt
gtccaggagtacctagagctcattggacggccagccctcccctcatactgggcacttggg
tttcatctcagtcgttatgattatgggaccttagataacatgaaagaagtcgtggacaga
aaccgtgcagcgcagctcccttacgatgttcagcatgctgatattgactacatggatgcg
aggaaggacttcacttatgacccagtaaattttaagggcttccctgagtttgcgaaggag
ttacacagtaatggacagaaactggtcatcattgtggatccagccatctccaacaactct
tccctaagcagtccctatggcccatatgacaggggttccgatgtgaagatctgggtgaat
gcatcagatggagtcactccactcattggggaggtctggcctggaaaaactgtatttcct
gatttcactaatccccagtgtactgcttggtggacaaatgaatttgagcttttccacaat
caagtggagtttaatggaatctggattgatatgaatgaagttgccaacttcgttgatggt
tcggtttcaggatgctccacaagcaatctaaattatccccctttcactcccagagtcctg
gatgggtacctgttccgcaagagcctctgcatggatgcagtgcagcactggggcaagcat
tacgatgtccacagtctgtatggctactccatggccattgccacctcagaagctgtcaag
actgtgttccctaacaagagaagcttcattttaacccgttctacctttgcggggtctggc
aagtttgcagcccactggttaggagacaacgcggccacctggagcgacctccagtggtcc
atccctgccatgctcgagttcaacctttttggtatcccaatggtgggttctgacatatgt
ggctttacactggatgctcctgaagagctctgcaggaggtggatgcagctgggagcattt
tatccattttccaggaatcacaattgccaaggctacaaggcccaggaccctgcctccttt
ggagctgattctctgctgctgaattcctccaggcactaccttactgtccgctacactctg
ctgccccacctctacaccctcttctaccaggcccacagccggggggacacggtggccagg
ccccttctgcacgagttctatgcggacagcaacacgtgggatgtgcaccagcagtttctc
tgggggcccagcctgctcatcactccagttctcaatgagggtgcagagaaagtgacagcg
tatgtgcctgacgccgtctggtatgactacgagactggggcccgcgtgagatggaggaag
cagagagtggagatggaacttcctggagacaaaatcgggcttcaccttcgaggtggctat
atcttccccacacaacagccggccacaaccacggaggccagtcgaaggaaccctcttggt
cttatcattgccctagatgagaataaagaagcaaaaggcgaacttttctgggatgatggg
gaaacgaaagatactgtggccaataaagcttatctcttatgtgagttttccgtcacccaa
aaccgcttggatgtgaaaattttgcagtcaacctacacagaccccaataatttagtattt
aaagagattaaaatccttgggacccaggaacctaccaacattacagtgaaacacaatggt
gtccacccaagtcatgtttctcctaatgtcacttatgattctgccctacaggtggccctc
atcacaggaattgaccttgtcctgggagaagcatacacggtggagtgggatgtgaagata
agggatgcagaaaaaatagactgttaccctgatgagaatggtgcttctgcggaaaactgt
gctgcccgcggctgtgtctgggaggaatccagttctcctggagtccctttctgctatttc
atcaatgatctgtactctgttggtgatattcagtatgactcccatggggccacagctgtc
atctccttgaagtcttccccttatgcctacacattgccctcgacacctgtgagctccctc
cgtctggatgtgacctaccataaggataacatgctgcagtttaagatttatgatcccgac
aacaaccggtatgaagtcccaatccctctcaacatccccgaggttccatccagcacccct
gagagtcgactctatgaggtcctcattaagaagaacccatttgggattgaagttcgtcgg
aagagtacgggcactgtaatctgggactctcagctccttggcttcacgttcaacgacatg
ttcatccgcatctccacgcgcctcccctcccagtacctctatggctttggggaaaccgag
cacacggcctttcgaagagacttgaactggaacacgtggggcatgttttccagagaccag
cccccagggtacaagaagaattcctacggtgtccacccctactacatggcactggaggag
gacggcagtgcccacggagtgctcctgctaaacagcaatgccatggatgtgacattccag
cccttgcctgctttgacgtaccgtaccacaggaggagttctggacttctatgtggtgttg
gggccaactccagagcttgtcacccagcagtacactgagttgattggtcggccagtgatg
gttccttactggtccttggggtttcagctgtgtcgctatggataccagaacgacgctgag
attgccagcttgtatgatgacatggtggctgcccagatcccctatgatgtgcagtacgcc
gacatcgactacatggagcggcagctggacttcaccctcggccccgaatttgctgggctc
ccagctctgattacacgcatccaggctgacgggatgcgggtcatcctcatcctggaccca
gccatctctggcaacgagacaaagccctatcctgccttcacgcggggtgtggaggaagat
gtcttcatcaaagacccaagcgatggaagcattgtctggggaaaggtctggcctgatttt
cctaatgttgttgtaaactcgtctctagactgggacactcagctggagctataccgagct
tatgtggccttcccggactttctccgtaattcaactatcacgtggtggaagagggagttg
agagaactctacaccaatccacggaatccagagacgagcttgaagtttgatggcatgtgg
attgacatgaatgagccggccagctttgtgaatggggcggttcccccaggctgcaagaac
gccactctgaaccacccaccctacatgccgcatttggagtccagggacaagggcctgagc
agcaagaccctgtgcatggagagccagcagatcctgcctgacggctccccggtgcggcac
tacgacgtgcacagcctgtacggctgggcccagaccagacccacgtacgaagctgtgcag
gaggtgacgggagagcgaggcattgtcgtcactcgctccactttcccctcttctggccgc
tggggaggacactggctgggagacaacacggccgcgtgggaccagctgaggaaatctatc
attggcatgatggagttcagcctctttggcataccctatacaggagcagatatttgcggg
ttctttcaagatgccgaatatgaaatgtgtgctcgctggatgcagctgggggccttctac
ccctattcgaggaaccataacaccattgggaccaggaggcaagaccctgtgtcctggaat
gctacctttgtgactctgtccagaagcgtcctgcggaccagatacaccctgttgccttat
ctctacaccctgatgcacgtggcccacgtggagggcagcaccgtcgtgcggcctcttctc
catgagtttgtggcagaccgggtgacctgggatgtagacggtcagttcctgctgggccca
gccttcctggtcagccctgtcctgcagcctggtgccgcagacgtcactgcatacttcccc
agagcccgctggtatgattactacacgggtgtggacattaaagcccggggagagtggaag
tccttgccagcccctctcgaccacattaatcttcatgtccgtgggggctacatcctgccc
tggcaagagcctgcacagaacacccacttaagccgtcagaagttcctaggcttcaaggtc
gccctggatgatcaggggacggccgaaggttgtctattctgggatgacggacaaagcatc
gatacctatgaaaaaggactctattacctggccaacttttctgtcagccagaatacgatg
cagagccatgtaattttcaacaaatacatcagcgatacaaaccctttgaaactgggctac
gttgaaatctggggagtgggcagcgattccatttccagtgtcagcatttctgtgagcggc
gtggttgtgacccccagcttcacctatgactctacaacacaggtgttaaacattgatgtg
accagcagaaacatcagcctgcataatttcacctccttgacatggagaagcactctgagt
tcctag

DBGET integrated database retrieval system