KEGG   Camelus dromedarius (Arabian camel): 105097829
Entry
105097829         CDS       T04642                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04350  TGF-beta signaling pathway
cdk04371  Apelin signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04714  Thermogenesis
cdk04910  Insulin signaling pathway
cdk04931  Insulin resistance
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105097829 (RPS6KB1)
   04350 TGF-beta signaling pathway
    105097829 (RPS6KB1)
   04371 Apelin signaling pathway
    105097829 (RPS6KB1)
   04066 HIF-1 signaling pathway
    105097829 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    105097829 (RPS6KB1)
   04152 AMPK signaling pathway
    105097829 (RPS6KB1)
   04150 mTOR signaling pathway
    105097829 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105097829 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    105097829 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105097829 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    105097829 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    105097829 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    105097829 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105097829 (RPS6KB1)
   05205 Proteoglycans in cancer
    105097829 (RPS6KB1)
   05231 Choline metabolism in cancer
    105097829 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105097829 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105097829 (RPS6KB1)
   05212 Pancreatic cancer
    105097829 (RPS6KB1)
   05225 Hepatocellular carcinoma
    105097829 (RPS6KB1)
   05226 Gastric cancer
    105097829 (RPS6KB1)
   05221 Acute myeloid leukemia
    105097829 (RPS6KB1)
   05224 Breast cancer
    105097829 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105097829 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105097829 (RPS6KB1)
   05163 Human cytomegalovirus infection
    105097829 (RPS6KB1)
   05165 Human papillomavirus infection
    105097829 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105097829 (RPS6KB1)
   01522 Endocrine resistance
    105097829 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105097829 (RPS6KB1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105097829 (RPS6KB1)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   105097829 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 105097829
NCBI-ProteinID: XP_010988747
LinkDB
Position
16
AA seq 525 aa
MRPRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggccacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggatcagccagaagacgcgggctct
gaagatgagctggaggaggggggtcagttaaatgagagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccagagaatatcatgcttaatcaccaaggtcatgtgaaactaacagattttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaaccgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggcgaagttcaagctcatccattcttcagacacattaactgggaagaactg
ctggctcggaaggtggagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccgtctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacggcaaaccctcagacacctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacgatgagtggcgaagcttcagcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcctatgatctccaaacgaccagagcac
ctgcgtatgaatctatga

KEGG   Camelus dromedarius (Arabian camel): 105104425
Entry
105104425         CDS       T04642                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04350  TGF-beta signaling pathway
cdk04371  Apelin signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04714  Thermogenesis
cdk04910  Insulin signaling pathway
cdk04931  Insulin resistance
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105104425 (RPS6KB2)
   04350 TGF-beta signaling pathway
    105104425 (RPS6KB2)
   04371 Apelin signaling pathway
    105104425 (RPS6KB2)
   04066 HIF-1 signaling pathway
    105104425 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    105104425 (RPS6KB2)
   04152 AMPK signaling pathway
    105104425 (RPS6KB2)
   04150 mTOR signaling pathway
    105104425 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105104425 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    105104425 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105104425 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    105104425 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    105104425 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    105104425 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105104425 (RPS6KB2)
   05205 Proteoglycans in cancer
    105104425 (RPS6KB2)
   05231 Choline metabolism in cancer
    105104425 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105104425 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105104425 (RPS6KB2)
   05212 Pancreatic cancer
    105104425 (RPS6KB2)
   05225 Hepatocellular carcinoma
    105104425 (RPS6KB2)
   05226 Gastric cancer
    105104425 (RPS6KB2)
   05221 Acute myeloid leukemia
    105104425 (RPS6KB2)
   05224 Breast cancer
    105104425 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105104425 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105104425 (RPS6KB2)
   05163 Human cytomegalovirus infection
    105104425 (RPS6KB2)
   05165 Human papillomavirus infection
    105104425 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105104425 (RPS6KB2)
   01522 Endocrine resistance
    105104425 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105104425 (RPS6KB2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105104425 (RPS6KB2)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   105104425 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 105104425
NCBI-ProteinID: XP_010996434
LinkDB
Position
Unknown
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPELSSADVCPLAELRAAGLEPVGHYEEVELTETSVNPGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLSEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAAEVQRHPFFRHINWDDLLARRMDPPFRPCLQSEEDVSQFDS
HFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPPLPPLLPAPPPPPPSSTAPLPIRPPSGTKKSKRGR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagactgaggaaggcagcgagggcgagggcgag
ccagagttaagctccgcggacgtgtgcccccttgccgagttgagggcagctggcctggag
ccagtgggacactatgaggaggtggagttgactgaaaccagtgtgaacccgggccctgag
cgcattggaccccactgctttgagctgctgcgtgtgctagggaaggggggctacggcaag
gtgttccaagtgcgaaaggtgcagggcaccaatctgggcaaaatatatgccatgaaagtt
ttaaggaaggccaagattgtgtgcaacgccaaggacacggcacatacacgggctgagcgg
aacattctagagtcagtgaagcatcccttcattgtggaactggcctatgccttccagact
ggcggcaaactctacctcatccttgagtgcctcagtggtggtgagctcttcacacatctg
gagcgagagggcatcttcctggaagacacggcctgtttctacctgtcagagatcacactg
gccctgggccatctccactcccaaggcatcatctaccgggacctcaagcctgagaacatc
atgctcaacagccagggccacatcaaactgaccgactttggactgtgcaaggagtcgatt
cacgagggcgccgtcacccacaccttctgtggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcttgggcgccctgatgtac
gacatgctcactggatcgccacccttcactgcagagaaccggaagaagaccatggacaag
atcatcaaagggaagctggcgctgcccccctacctcaccccggatgcccgggacctcgtc
aaaaagtttctgaagcggaatcccagccaacggattgggggtggcccaggagacgctgct
gaggtgcagcggcaccccttcttccggcacattaattgggacgacctcctggcccgccgc
atggacccccctttccggccctgtctgcagtcagaggaagacgtgagccagtttgactcc
cacttcacaaggcagacaccagtggacagtccagacgacacggcactcagtgagagtgcc
aaccaggccttcctgggcttcacgtacgtggcaccctccgtgctggacagcatcaaagag
ggcttctccttccagcccaagctgcgctcccccaggcgcctcaacagcagcccccggacc
cccatcagccccctgaagttttcgccctttgagggattccggcccagccctggcccacca
gaacccatggagcctcctctacctcctctcctgccagcgcccccaccaccgccaccctcg
agcactgcccctctccccatccgacccccctcagggaccaagaagtccaagaggggccgt
gggcgccctgggcgctag

DBGET integrated database retrieval system