KEGG   Camelus dromedarius (Arabian camel): 105097907
Entry
105097907         CDS       T04642                                 

Gene name
ILK
Definition
(RefSeq) integrin-linked protein kinase isoform X1
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04360  Axon guidance
cdk04510  Focal adhesion
cdk05100  Bacterial invasion of epithelial cells
cdk05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105097907 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105097907 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    105097907 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    105097907 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105097907 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105097907 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105097907 (ILK)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105097907 (ILK)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: TKL group
  MLK family
   105097907 (ILK)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105097907 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 105097907
NCBI-ProteinID: XP_010988838
UniProt: A0A5N4DMX3
LinkDB
Position
10
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKMLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggttgccgtccgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagaaggacgctctgctgtggttgagatgctgatcatgcggggggcacgaatc
aatgtgatgaaccgtggggatgacacacccctgcacctggcagccagtcacggacaccgt
gatattgtacagaagctgctgcagtacaaagctgacatcaacgcagtgaatgagcatggg
aatgtgcccctgcactatgcttgtttctggggtcaagatcaggtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctgaac
cgtattccatacaaggatacattctggaaggggaccacccgcactcggccccgaaatggg
actctgaacaaacactccggcattgacttcaaacagctcaacttcctggcgaagctcaac
gagaatcactctggagagctatggaagggccgctggcagggcaatgacatcgtcgtgaag
atgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaggagtgtccc
cggctcaggattttctcacacccgaacgtgctcccagtgctaggtgcctgccagtctcca
cccgctcctcaccccaccctcatcacacactggatgccatatggatccctgtacaacgtg
ctacacgaaggcaccaattttgttgtggaccagagccaggctgtgaagtttgcactggac
atggcaaggggcatggccttcctgcacacactagagcccctcatcccacgacatgcactt
aacagtcgtagtgtaatgattgatgaggacatgactgcacgaatcagtatggccgacgtc
aagttctccttccagtgccccgggcgcatgtatgcacctgcctgggtggcccctgaagct
ctgcaaaagaagcctgaagacacaaacagacgctcagcagatatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaacatggaaatt
ggaatgaaggtggcactggaaggcctccggcctaccatcccaccaggcatttccccccac
gtatgtaagcttatgaagatctgcatgaatgaagaccctgctaagcggcccaagtttgac
atgattgtgcctatcttggagaagatgcaggacaagtag

DBGET integrated database retrieval system