KEGG   Camelus dromedarius (Arabian camel): 105098271
Entry
105098271         CDS       T04642                                 

Gene name
SHH
Definition
(RefSeq) LOW QUALITY PROTEIN: sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04340  Hedgehog signaling pathway
cdk04360  Axon guidance
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05217  Basal cell carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105098271 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    105098271 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105098271 (SHH)
   05205 Proteoglycans in cancer
    105098271 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    105098271 (SHH)
   05217 Basal cell carcinoma
    105098271 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105098271 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105098271 (SHH)
Peptidases and inhibitors [BR:cdk01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105098271 (SHH)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Morphogens
   105098271 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 105098271
NCBI-ProteinID: XP_010989235
LinkDB
Position
7
AA seq 466 aa
MDKMLLLARCLLVVLISSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSDESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLXPGDRVLAADDQGQLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNGSALGARGAVGAGRPPGGA
XGAPGLFASSVRPGPHVYVVAERGGDRRLLPXPVHSVTLREEATGAYAPLTAQGTILINR
VLASCYAVIEEHGWAHRAFAPFRLAHALLARWRLAHGPRAGTGRGRRRRRGGGGRVPPRA
QRPGAPGTAAAAGPGVHWYSQLXYQIGTWLLDSEALHPLGMAVKSS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggacaagatgctgctgctggcgagatgtctgctggtggtgctaatctcctcgctgctg
gtgtgctcggggctggcgtgcggacccggcaggggatttgggaagaggcggcaccccaaa
aagctgacccctttagcctacaagcagtttatccccaacgtggctgagaagaccctaggg
gccagtggaagatacgaagggaagatcacgagaaactcggagcgatttaaggagctcacc
cccaattacaaccccgacatcatatttaaggatgaagaaaacactggagcggaccggctg
atgactcagaggtgcaaggacaagctgaatgccttggccatctccgtgatgaaccagtgg
ccaggagtgaagctgcgggtgaccgagggctgggacgaggatggccaccactcagacgag
tccctgcactacgagggccgtgcagtggacatcaccacgtcggaccgcgaccgcagcaag
tacggcatgctggcccgcctagcggtggaggccggctttgactgggtctactacgagtcc
aaggcgcacatccactgctccgtgaaagcagagaactcggtggcagccaaatcgggcggc
tgcttcccgggctcggccacggtgcacctggaacagggcggcaccaagctggtgaaggat
ctgncgcccggggaccgcgtgctggcggccgacgaccagggccagctgctctacagcgac
ttcctcaccttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacg
cgggagccccgcgagcgcctgctgctcaccgccgcacacctgctctttgtcgcgccgcac
aacggctcggccctgggagcccgaggcgctgtcggcgctgggcggccgccggggggcgcg
nccggcgcgccggggctcttcgctagcagcgtgcggccgggcccgcacgtgtacgtggtg
gccgagcgcggcggggaccgccggctgctgcccnnccccgtgcacagcgtgacgctgcgc
gaggaagccacgggcgcgtacgcgccgctgacggcgcagggcaccatcctcatcaaccgg
gtgctggcgtcgtgctacgcggtcatagaggagcacggctgggcgcaccgggccttcgcg
cccttccgcctggcgcacgcgctcctggcccgctggcgcctcgcgcacggaccgcgcgcg
gggacggggcgggggcggcggcggcggcgcgggggcggcggtcgcgtccccccccgcgcc
cagcgcccgggtgcgccaggtacggccgccgccgccggcccgggcgtccactggtactcg
cagctgncttaccaaataggcacctggctgttggacagcgaggccttgcacccgctcggc
atggcggtcaagtccagctga

DBGET integrated database retrieval system