KEGG   Camelus dromedarius (Arabian camel): 105098486
Entry
105098486         CDS       T04642                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105098486 (PDGFRB)
   04014 Ras signaling pathway
    105098486 (PDGFRB)
   04015 Rap1 signaling pathway
    105098486 (PDGFRB)
   04630 JAK-STAT signaling pathway
    105098486 (PDGFRB)
   04020 Calcium signaling pathway
    105098486 (PDGFRB)
   04072 Phospholipase D signaling pathway
    105098486 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    105098486 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105098486 (PDGFRB)
   04540 Gap junction
    105098486 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105098486 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105098486 (PDGFRB)
   05206 MicroRNAs in cancer
    105098486 (PDGFRB)
   05230 Central carbon metabolism in cancer
    105098486 (PDGFRB)
   05231 Choline metabolism in cancer
    105098486 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    105098486 (PDGFRB)
   05218 Melanoma
    105098486 (PDGFRB)
   05215 Prostate cancer
    105098486 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105098486 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105098486 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105098486 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cdk04090]
    105098486 (PDGFRB)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105098486 (PDGFRB)
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   105098486 (PDGFRB)
CD molecules [BR:cdk04090]
 Proteins
  105098486 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 105098486
NCBI-ProteinID: XP_010989474
LinkDB
Position
3
AA seq 1102 aa
MWLPSAMPAPVLKGQELLLPLLLLLGPQASWGLVITPPGPELVLNLSSTFVLTCSGPAPV
VWERMSQNPPQEITKTQDGTFSSKLTLANVTGLHTGEYFCTYNGSHGLEASERKRLYIFV
PDPTIGFLPVDPEELFIFLTEITEITIPCRVTDPRLVVTLHEKKVDVPLPISYDHQRGFS
GTFEDKTYVCKTTIGDREVDSDAYYVYSLQVSSINVSVSAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSDSVSDHR
DEKAINVTVVESGYVQLLEELDPVQFAELHRSRTLHVVFEAYPPPTVMWFKDNRTLGDSS
AGEIVLSTRNVSETRYVSELTLVRVKVAEAGSYTMRAFHEDAEAQLSFQLQVNVPVRVLE
LSESHPASGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSQEESQLETNVT
YWAEEQEFEVVSTLRLRRVDQPLSVRCTLHNLLGHDMQEVTVVPHSLPFKVVVISAILAL
VVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCSDKRRPPSAELYSNALP
GGLPLLSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPS
APERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLDTSSVLYTAVQPEGDNDYI
IPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPQPECQVEPEP
EPERSPDSSCLGPRAEAEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgtggcttccgagtgccatgcctgctcctgtcctcaaaggccaggagctgttgctgccc
ctgctgttgctgctgggaccacaggcctcctggggcctggtcatcacacccccggggccg
gagcttgtcctcaatctctccagcacctttgttctgacctgctcgggtccagctccagtg
gtgtgggaacggatgtcccagaaccccccacaggaaataaccaagacccaggacggcacg
ttctccagcaagctgacactggccaacgtcactgggctccacacgggagaatacttttgt
acctacaacggctcccatgggctggaggccagtgagcggaaacggctgtacatctttgtg
ccagatcccaccataggcttccttcctgtcgaccctgaggaactcttcatctttctcacg
gaaataactgagatcacaattccatgccgagtgacggatccacgattggtggtgacactg
catgagaagaaggtggatgtcccactgcccatctcctatgaccaccaacgtggcttctct
gggacctttgaggacaagacctatgtctgcaaaaccaccatcggggacagggaagtggat
tctgatgcctactatgtctacagcctccaagtgtcatccatcaatgtctcagtgagtgca
gtgcagactgtggtccgccagggggagaacatcaccattatgtgcattgtgacggggaat
gaggtggttaactttgagtggacatacccacgcatggagagtgggcggctggtagagcca
gtgactgacttcctctttgaaatgccccacatacgttctatcctgcacatccccagtgcc
gagctgggagactcagggacctacatctgcaatgtatcagatagtgtgagcgaccatcga
gatgaaaaggccatcaatgtcactgtagtcgagagcggctatgtgcagctgctggaggag
ctggaccctgtacaattcgcggagctgcaccgcagccggacactgcacgtggttttcgag
gcctacccgcctcccactgtcatgtggttcaaggacaacaggaccctgggtgattccagc
gccggcgagatcgtgctgtccacacgcaatgtgtcggagacccggtatgtgtcagaactg
acactggtgcgggtgaaggtggctgaggctggcagctacaccatgagggccttccatgag
gatgctgaggcccagctctccttccagctgcaggtcaatgtgcccgtccgtgtgctggag
ctgagtgagagccaccctgccagcggggagcagacagtccgctgtcgcggccggggcatg
ccccagccacacctcacctggtccacgtgtagcgacctcaaaaggtgtccgcgcgagctg
ccgcccacgccactggggaacagttcccaggaggagagccagctggagacgaacgtgacg
tactgggcggaggagcaggagttcgaggtggtgagcacgctgcgcctgcgccgcgtggat
cagcccctgtcggtgcgctgcacgctgcacaacctgctgggccacgacatgcaggaggtc
accgtggtgccgcattccctgcccttcaaggtggtggtgatctcagccatcctcgccttg
gtcgtcctcacaatcatctccctcatcatcctcatcatgctctggcagaagaagccacgc
tacgagatccgatggaaggtgattgaatctgtgagctctgatggccacgagtacatctat
gtggaccctatgcagctgccctatgactccacctgggagctgcctcgggaccagcttgtg
cttggacgcaccctgggctccggggcctttgggcaggtggtggaggccacggctcatggc
ctgagccattcacaggctaccatgaaggtggccgtcaagatgctaaaatctacagcccgc
agcagtgagaagcaagccctcatgtcagagctgaagatcatgagtcacctcgggcctcac
ctgaacgtggtcaacctgctgggagcctgcactaaaggagggcccatctacatcatcacc
gagtactgccgctacggcgacctggtggactacctgcaccgcaacaagcacaccttcctg
cagcgctgctccgacaagcgccgcccgcccagtgccgagctctacagcaacgccctgccc
ggcgggctccccctgctcagccacgtgtccctgcctggggagagtgacggcggctacatg
gacatgagcaaggatgagtcagtggactacgtgcccatgctggacatgaaaggggatgtc
aaatacgcagacatcgagtcctccaactacatggctccttacgataactacgtcccctct
gctcctgagaggacctgccgggcgactttgatcaacgagtccccagtgcttagctacacg
gatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaagaac
tgcgtccaccgagacctggcggccaggaatgtgctcatctgtgagggcaagctcgtcaag
atctgtgactttggcctggctcgtgacatcatgcgggactcgaactacatctccaagggc
agcaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctctacacc
accctgagtgacgtgtggtccttcgggatcctgctctgggagatcttcaccctgggtggc
accccgtacccagagctgcccatgaacgagcagttctataatgccatcaaacggggctac
cgcatggcccagcccgcccacgcctccgacgagatctacgagatcatgcagaagtgctgg
gaagagaagtttgagattcggccacccttctcccagctggtgctgcttctcgagagactg
ctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgac
cacccagccgtccttcggtcccaagcccgcttgcccggcttccacggcctgcgatccccg
ctggacaccagctccgtcctctacactgctgtgcagcccgagggtgacaacgactatatc
attcccctgcccgaccccaaacccgaggtcgctgatgagggcccgctggagggttccccc
agccttgccagctccaccctgaatgaagtcaacacctcatctaccatctcctgtgacagc
cccctggagccccaagaggaaccagagccccagcctgagtgccaggtggagccggagcca
gagccagagcggtcgccggattcaagctgcctcgggcctcgggctgaggcagaggacagc
ttcctgtag

DBGET integrated database retrieval system