KEGG   Camelus dromedarius (Arabian camel): 105098591Help
Entry
105098591         CDS       T04642                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00250  Alanine, aspartate and glutamate metabolism
cdk00280  Valine, leucine and isoleucine degradation
cdk00410  beta-Alanine metabolism
cdk00640  Propanoate metabolism
cdk00650  Butanoate metabolism
cdk01100  Metabolic pathways
cdk04727  GABAergic synapse
Module
cdk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105098591 (ABAT)
   00650 Butanoate metabolism
    105098591 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105098591 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    105098591 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105098591 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    105098591 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cdk01007]
    105098591 (ABAT)
Enzymes [BR:cdk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105098591 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105098591 (ABAT)
Amino acid related enzymes [BR:cdk01007]
 Aminotransferase (transaminase)
  Class III
   105098591 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 105098591
NCBI-ProteinID: XP_010989604
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASMLLTRRLACRFQHSYHLLVPGSRQISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALMKLVQQPQ
NVSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSGFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPQLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLVGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgctgctcacccggcggctggcctgcagattccaacacagctaccacctg
cttgtgcccggatctagacagatcagtcaggctgcagccaaagtcgacgttgaatttgat
tatgacgggcctttgatgaagacggaagtcccagggcctcgatctcgggagttaatgaaa
cagctaaatataattcagaatgcagaggccgtgcactttttctgcaattatgaagagagc
cgaggcaattacctggtagatgtggatggcaaccggatgttggatctttattcccagatc
tcctcggtccccataggttacagccatcccgctctcatgaaactcgtccaacagcctcaa
aatgtgagcacattcatcaacagacctgccctcggaatccttcctccagagaactttgtg
gagaagctccgggagtccctgctctcggtggctcctaaaggaatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttcaagaccatcttcatgtggtatcgg
agcaaggaaaggggccagtcaggtttctccaaggaggagctggagacgtgcatgattaac
caggcccccgggtgccctgactacagcatcctctccttcatgggcgcgttccacgggagg
accatgggttgcttagcgaccacgcactccaaagccattcacaagattgacatcccttcc
ttcgactggcccatcgcaccattcccccagctgaagtatcccctggaagagtttgtgaag
gagaaccagcaggaagaggcccgctgtctagaagaggtggaggacctgatcgtgaagtac
cggaagaagaagaagacagtggctgggatcatcgtggagcccatccagtcagagggcgga
gacaaccatgcgtcagacgacttcttccggaagctgagagacatctccaggaagcacggc
tgcgccttcttggtggatgaggtccagacaggagggggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgacccggcagacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcccaacgctccttaccggatcttcaac
acgtggctgggggacccatccaagaacctgctgctggccgaggtcatcaacattatcaag
cgggaggaccttctgaacaacgccgcgcatgccgggaaggccctgctcgtgggcctgctg
gacctccaggcccggtacccccagttcatcagcagagtgagaggacgaggcaccttctgc
tccttcgacactccagacgaatccatacggaataaactcatttcaatagctagaaacaaa
ggcgtgatgctggggggctgcggcgacaagtccatccgtttccgtcccactctggtcttc
agggatcaccatgcacacctgttcctcaatattttcagcgacatcttagccgacttcaag
taa

DBGET integrated database retrieval system