KEGG   Camelus dromedarius (Arabian camel): 105098684Help
Entry
105098684         CDS       T04642                                 

Gene name
NUB1
Definition
(RefSeq) NEDD8 ultimate buster 1
Organism
cdk  Camelus dromedarius (Arabian camel)
SSDB OrthologParalogGFIT
Motif
Pfam: Ubiquitin_5 UBA HOIP-UBA TPR_12 R3H-assoc
Motif
Other DBs
NCBI-GeneID: 105098684
NCBI-ProteinID: XP_031311571
LinkDB All DBs
Position
7
AA seq 614 aa AA seqDB search
MAQKKYLQAKLTQFLREDRIQLWKPPYTNENKEVGLALKDLAKKYSDKLECCENEVEKII
EEIRCKAIERGTGNEHYKTTGIATIEVFLPSRLKRDRKNLLETRLHITGRELRSKIAETF
GFQENYIKIVINKKQLQLGETLEDQGVTHNVKAMVLELKQSEEDARKNTQVEEEEQCEAK
LKEKRIQRTKRGLEILAERAEMVVDPETTPYLDIANQTGRSIRIPPSERKALMLAMGYHE
KGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLGQLECLE
DAEKKLNMAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNGEEACE
YLNKARQLFKELYIDPSKVHNLLQLGFTAQEARLGLRACDGNVDHAAAHITNRREELDQI
RKEEREKKRRRLENINYLKEMGYSTHAAKQALHQAVGNLEEALKILLSNPRMWLLNDSDP
ETNKHQESPSQENIDQMVYMGFDAAAARAALKVFRGNVQLAAQTLALNGGSLPPDLQLSV
EDSSPSPSTSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEY
LSYVENIKSATKKN
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaagaagtatctccaagcaaaattgactcagtttttaagggaagacagaatt
caactttggaaacctccatatacaaatgaaaataaagaagttggtttggcactgaaggac
cttgctaagaagtactctgacaagctagaatgttgtgaaaatgaagtagaaaagataata
gaagaaatacgttgcaaagcaatcgagcgtggcacaggaaatgaacactataaaaccaca
ggaattgctacaattgaagtctttttaccctcgcgattaaaaagagataggaaaaacttg
ttggaaacccgactgcacatcactggcagagaactgagatctaaaatagctgaaactttt
ggatttcaagaaaattatatcaaaattgtcataaataagaaacaacttcaactaggagaa
acactcgaggatcaaggagtgactcacaatgtaaaagctatggtgctcgaattgaagcag
tctgaagaggatgcgagaaaaaacacccaggttgaagaagaagagcaatgtgaagccaaa
ctaaaagaaaaaagaattcagaggactaagagagggctggagatactggcagagagagct
gagatggtggtggatccagaaaccacaccgtacttagacatagctaaccagacaggcaga
tcaatcagaatccctccatcagaaagaaaagcccttatgttagcaatgggatatcatgag
aagggcagagctttcctgaaaagaaaagaatatggaatagccctgccgtgcctgttggat
gctgacaaatatttctgcgagtgctgcagagaactgctggatacggtggataactacgca
gtgctccagctggatatagtgtggtgctacttccgcttgggacagctggaatgccttgaa
gatgcagagaaaaaattaaacatggcccagaaatgctttaaaaattgctatggagaaaat
catcagagactggtccacataaaaggaaattgtggaaaagagaaggtcttgtttttaaga
ctttacttgcttcagggtatccgaaattatcacagtggaaatggtgaagaggcttgtgaa
tatctcaacaaggcacgtcagctctttaaggagctgtatattgatccatcaaaagttcac
aatttgttgcagctgggatttactgcccaggaagctcggctgggcctgagggcatgtgac
gggaacgtggaccatgcagctgcccacatcaccaaccgcagagaggaattggaccaaata
aggaaggaggagagagagaagaagagacgccgcctggagaacataaactatttgaaagaa
atgggctactccacgcatgcagccaagcaggctctccaccaggcggtcgggaacctggag
gaggccctgaagattcttctcagtaaccctcggatgtggttgttaaatgactcagatcct
gaaaccaacaagcatcaagaaagtccttctcaggagaacattgaccagatggtgtacatg
ggcttcgacgcggcggcggccagagcggccctgaaagtgttcagggggaatgtccagctg
gcagcccagaccctcgctctcaatggaggaagtctccctcccgacctgcagctctcggtg
gaagattcttcaccatcaccatccacgtccccgtccgattctgcaggtacatctagtgcc
tcaactgatgaagatatggagacagaggctgtcaatgagatactggaagatattccagaa
catgaagaagattatcttgactcaactctagaagatgaagaaattattattgcagagtac
ttatcctatgtagaaaatataaagtcagcaacaaagaaaaactaa

DBGET integrated database retrieval system