KEGG   Camelus dromedarius (Arabian camel): 105098843Help
Entry
105098843         CDS       T04642                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00010  Glycolysis / Gluconeogenesis
cdk00020  Citrate cycle (TCA cycle)
cdk00620  Pyruvate metabolism
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
cdk04068  FoxO signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04910  Insulin signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
cdk04931  Insulin resistance
cdk04964  Proximal tubule bicarbonate reclamation
Module
cdk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105098843 (PCK1)
   00020 Citrate cycle (TCA cycle)
    105098843 (PCK1)
   00620 Pyruvate metabolism
    105098843 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105098843 (PCK1)
   04151 PI3K-Akt signaling pathway
    105098843 (PCK1)
   04152 AMPK signaling pathway
    105098843 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105098843 (PCK1)
   04922 Glucagon signaling pathway
    105098843 (PCK1)
   04920 Adipocytokine signaling pathway
    105098843 (PCK1)
   03320 PPAR signaling pathway
    105098843 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    105098843 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105098843 (PCK1)
Enzymes [BR:cdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     105098843 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-GeneID: 105098843
NCBI-ProteinID: XP_010989900
LinkDB All DBs
Position
19
AA seq 622 aa AA seqDB search
MPPQISDGHSYSAKVIQGSLESLSQAVRDFVESSAKLCQPDQIHICDGSEEENQQLLGRM
EEEGVIKRLKNYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIAKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIQLTDSPYVVASMRIMTRMGAPV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIVSFGSGYGGNSL
LGKKCFALRIASRLAKEEGWLAEHMLILGLTNPKGQKKYFAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKLDSQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQRNTIFTNV
AQTSDGGVYWEGIDQPLASGIRLTSWKNKEWSPEDGEPCAHPNSRFCTPASQCPIIDPAW
ESPEGVPIEGIIFGGRRPTGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF
AMRPFFGYNFGHYLTHWLSMAQRPAAKLPKIFHVNWFRKDKDGRFLWPGFGENSRVLEWM
FNRINGEGGARPTPIGYVPAEGALDLRGLGDVNVKELFHISKEFWEEEVEEIQKYLEEQV
NADLPYEIKSQVLALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagatctcagacggccacagctactcagccaaagtcatccagggctcgctc
gagagcctatcccaggctgtgagggatttcgtggagagcagcgccaagctgtgtcagcct
gaccagatccacatctgcgatggctccgaggaggagaaccagcagctactgggccgcatg
gaggaagagggtgtcatcaagaggctgaagaattacgacaactgctggttggctctcacc
gaccccagggatgtggccagaattgaaagcaagactgtcattattactcaagagcaacga
gatacggtgcccatcgccaaaactggcctcagccagctgggtcgctggatgtccgaggag
gactttgagaaggcatttaatgcccggttcccagggtgcatgaaaggtcgcaccatgtat
gtcatcccgttcagcatggggccgctgggctcacctctgtccaagatcggcatccagctg
accgactcgccctacgtggtggccagcatgcgcatcatgacgcgaatgggcgcgcctgtc
ctggaagcgctgggtgatggagagttcgtcaagtgcctccactctgtgggctgccctttg
cctttaaaaaagcctttggttaacaactgggcctgtaacccagagctgacgctcatcgcc
cacctgcccgaccgcagagagatcgtctccttcgggagtgggtacggtgggaactcgctc
cttgggaagaagtgctttgccctccggatagccagccggctggccaaggaggaggggtgg
ctggcagagcacatgctgattctgggcctaaccaaccccaagggccagaagaagtacttt
gccgctgcgtttcccagtgcctgcgggaagaccaacctggccatgatgaaccccaccctc
ccggggtggaaagtagagtgtgtgggtgatgacatcgcctggatgaagcttgactcacaa
gggaacttacgggctatcaacccagagaatgggttttttggcgttgctcctggaacctct
gtgaagacgaaccccaacgccattaagaccatccagaggaacaccatcttcaccaacgtg
gcccagaccagcgatggcggcgtttactgggaaggcatcgaccagccactggcctcgggc
atcaggctcacttcgtggaagaacaaggagtggagcccggaggatggggagccttgcgcc
caccccaactcgcgcttctgcacccctgccagccagtgccccatcattgacccagcctgg
gagtctccggaaggcgtgcccatcgagggcatcatcttcggagggcgccgacctacaggt
gtccctctggtctatgaagctctcagctggcagcatggagtgtttgtgggggcggccatg
aggtcggaggccacggcagctgcggagcacaagggcaaagtcatcatgcacgaccccttc
gccatgcggcccttcttcggctacaacttcggccactacctgacccactggcttagcatg
gcccagcgcccggcagccaagctgcccaagatcttccacgtcaactggttccggaaggac
aaggacggtaggttcctgtggccaggctttggcgagaactcccgggtgctggagtggatg
ttcaatcgcatcaacggggaaggcggcgccaggcccacgcccatcggctacgtccccgcg
gaaggcgccctggatctgcggggcctgggggacgtcaacgtgaaggagctcttccacatc
tccaaggagttctgggaggaggaggtagaagagatccagaagtacttggaggagcaagtg
aacgctgacctcccctacgagatcaagagccaggtcctggccctgaagcagaggatcagc
cagatgtaa

KEGG   Camelus dromedarius (Arabian camel): 105102409Help
Entry
105102409         CDS       T04642                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00010  Glycolysis / Gluconeogenesis
cdk00020  Citrate cycle (TCA cycle)
cdk00620  Pyruvate metabolism
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
cdk04068  FoxO signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04910  Insulin signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
cdk04931  Insulin resistance
cdk04964  Proximal tubule bicarbonate reclamation
Module
cdk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105102409 (PCK2)
   00020 Citrate cycle (TCA cycle)
    105102409 (PCK2)
   00620 Pyruvate metabolism
    105102409 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105102409 (PCK2)
   04151 PI3K-Akt signaling pathway
    105102409 (PCK2)
   04152 AMPK signaling pathway
    105102409 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105102409 (PCK2)
   04922 Glucagon signaling pathway
    105102409 (PCK2)
   04920 Adipocytokine signaling pathway
    105102409 (PCK2)
   03320 PPAR signaling pathway
    105102409 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    105102409 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105102409 (PCK2)
Enzymes [BR:cdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     105102409 (PCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_GTP PEPCK_N
Motif
Other DBs
NCBI-GeneID: 105102409
NCBI-ProteinID: XP_031309328
LinkDB All DBs
Position
6
AA seq 640 aa AA seqDB search
MAAVYRPGLRLSWHGLSPWGWSSWRSVQTLRVLSGDLGQVPAKVRDFVEHSARLCQPEGI
HICDGTEAENTAILTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPAEFQQAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPVGKKRYVAA
AFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSDGQLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDLPLPPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFSWRHGVFVGSAMRS
ESTAAAEHKGKVIMHDPFAMRPFFGYNFGRYLEHWLSMEGRKGVRLPRIFHVNWFRRDEA
GRFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLGAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALEGRVHKM
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtgtaccgccccggcctgcggcttagctggcatgggctgagcccctggggc
tggtcatcatggcgcagcgtccagaccctgcgagtcctcagtggagatctgggccaggtg
cctgctaaggttcgagactttgtggagcacagtgcccgcctctgccaaccagagggcatc
cacatctgtgatgggaccgaggctgagaacactgccatactgaccctgctggaacagcag
ggactcatccgaaagctccccaagtacaacaattgctggctggcccgtacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacggtg
cccctcccggctggtggggcccgtgggcagctgggcaactggatgtccccagctgagttc
cagcaagctgtggatgagaggtttccgggctgcatgcagggccggaccatgtatgtgctt
ccattcagcatgggtcccgtgggctccccactgtcccgcatcggagtgcagctcacggac
tcagcctacgtggtggcgagcatgcgcattatgaccaggttggggacgcccgtgttgcag
gctctgggagatggtgattttgtcaagtgtctgcactccgtgggccagcccctaactggg
caaggggagccggtgagccagtggccatgcaacccagagaaaaccctgattggccatgtg
cccgaccaacgggagatcgtctccttcggcagtggctatggtggcaactccctgctgggc
aagaagtgctttgcccttcgcatcgcctctcggctggcccgggatgagggctggctggcg
gagcacatgctgatcctgggtattaccaaccccgtggggaagaagcgttatgtggcagcc
gccttccccagtgcctgtggcaagacgaacctggccatgatgcggccagcactgccaggc
tggaaagtggagtgtgttggggatgacatcgcctggatgaggtttgacagtgatggtcaa
ctccgggccatcaaccctgagaatggcttctttggagtggcacctggcacctctgccacc
accaaccccaatgccatggccacaatccagagtaacactcttttcaccaacgtggctgag
accagtgatggcggcgtgtattgggagggcattgacctgcctcttccacctggtgtcacc
gtgacctcctggctgggcaaaccctggaaacctggtgacaaggagccttgtgcacatccc
aactctcgcttttgtgccccggctcgccagtgccccatcatggacccagcctgggaggcc
ccggagggtgttcccattgatgccatcatctttggaggtcgcagacccaaaggagtcccc
ctggtttacgaggccttcagctggcgccacggtgtgtttgtgggcagtgccatgcgctca
gagtccactgctgcagctgagcacaaagggaaggtcatcatgcatgacccatttgccatg
cggccctttttcggctacaactttgggcgctaccttgaacactggctgagcatggaaggg
cgcaagggggtccggctgccccgcatcttccatgtcaactggttccggcgtgacgaggca
ggccgcttcctgtggccaggctttggagagaatgctcgggtgctagactggatctgccgg
aggctagaaggggaggacagtgcccgagagacgcccatcgggctggtgccaaaggaaggc
gccttggatctcagcggcctgggagccatagacaccacccagctgttctcactccccaag
gacttctgggaacaggaagttcgtgacattcggagctacctgacagagcaggtcaaccag
gatctgcccaaagaggtgttggctgagctggaggccctggagggacgtgtgcacaaaatg
tga

DBGET integrated database retrieval system