KEGG   Camelus dromedarius (Arabian camel): 105098930Help
Entry
105098930         CDS       T04642                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03030  DNA replication
cdk03410  Base excision repair
cdk03420  Nucleotide excision repair
cdk03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105098930 (LIG1)
   03410 Base excision repair
    105098930 (LIG1)
   03420 Nucleotide excision repair
    105098930 (LIG1)
   03430 Mismatch repair
    105098930 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105098930 (LIG1)
   03400 DNA repair and recombination proteins [BR:cdk03400]
    105098930 (LIG1)
Enzymes [BR:cdk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105098930 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     105098930 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105098930 (LIG1)
DNA replication proteins [BR:cdk03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105098930 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105098930 (LIG1)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105098930 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     105098930 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     105098930 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR Glyco_hydro_92 PucR
Motif
Other DBs
NCBI-GeneID: 105098930
NCBI-ProteinID: XP_010989994
LinkDB All DBs
Position
Un
AA seq 907 aa AA seqDB search
MQRSIMSFFQPKKEGKVKKPEETSNSTRETESPPKAALKERNRMVPEGDSPVKRPGRKVA
RVLGSEGEEEEEAPSPLKGQKPAPDSPQNSPPHPVTLPKSPSLSNTSPAVLSPPAIPKRR
TARKQVPKRTFLEVLEEQSKDRVTEAKKKKEDKELETPSESLTEPEVGKNEEADAKEQPT
TPPRPRETPEAEPLTESVCKPEMATKQGPQEDGQTQPPRPAAKTLSSFFSPRKPAVKKEA
EEEGPGSVRKEAAKGHLDPPSYNPAKNNYHPIEDACWQPGQKVPYLAVARTFEKIEEVSA
RLRMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELGIGDGILLKAVAQATGR
QLESVRAEATEKGDVGLVAESSRSMQRLMLPPPALTAAGVFAKFRDIAQLAGNASTTKKM
DIIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAG
KGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLAHGLEQLPEHCRLSPGIPLKPML
AHPTRGVGEVLKRFEEAAFTCEYKYDGQRAQIHLLEGNQEDNTGRYPDVISRVPKIKLPS
VTSFILDTEAVAWDQEKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNGESLVR
EPLSRRRQLLRENFVETEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLMVKTLDTDAT
YEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEESEELQA
ICKLGTGFSDEELEEHHQSLQALVLPAPRPYVRADGAVTPDHWLDPSAVWEVKCADLSLS
PIYPAARGLVDSEKGISLRFPRFLRVREDKKPEQATTSAQVACLYRKQSQIQNQHGAEPD
SEPEDFY
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccagcccaagaaagaaggcaaagtgaagaagcca
gaggagacatccaacagcaccagagaaacagagtcccctccaaaggcggctctgaaagag
cggaatagaatggtgcctgagggcgactctccagtgaagaggccggggaggaaggtggcc
cgggtcctgggcagcgagggggaggaggaggaggaagccccctcgcccctcaaaggccag
aagcctgcaccagactctccacagaactcccctccccatcctgtcacacttcccaagagc
ccttccctctccaacacctctccagcagtcctctccccgccggcgatcccaaagcgtcgc
acagcccggaagcaggttcctaaacggacatttctggaagtcctggaagagcagagcaag
gacagggtcacagaagccaagaagaagaaggaggacaaagaactagagaccccatcagaa
agcctcacggagcctgaagtgggcaaaaacgaggaggcagatgcgaaggagcagcccacg
acgccccccagaccccgagagacccccgaagccgagcccctgacagaaagtgtttgcaag
cctgagatggcaacgaagcagggaccacaggaggacggccagacacagcctccccgccca
gctgccaagacactcagcagtttcttctccccccgaaagccggcagtcaaaaaggaagct
gaagaagagggacctggctctgtaagaaaggaggcagccaagggacacctggacccaccc
agctacaacccggccaagaacaactaccatcccattgaagatgcctgctggcagccgggc
cagaaggtcccttacctggccgtggcccggacctttgagaagatcgaggaggtttctgct
cggctccgcatggtggagacactgagcaacttgctgcgctccgtggtggccctgtcacct
ccagacctcctccccgtcctctacctcagcctcaaccgcctggggccgccccagcagggc
ctggagctgggcattggtgacggtatccttctcaaggcagtggctcaggccacaggtcgg
cagctggagtcggtccgggccgaggccacagagaagggcgacgtggggctggtggccgag
agcagccgcagcatgcagagactcatgctgcccccgcctgccctgaccgccgccggtgtc
ttcgccaagttccgggacatcgcccagctggccggcaatgcatccacaaccaagaagatg
gacatcatcaaaggcctctttgttgcctgccgccactcagaagctcggttcatcgccaga
gccctgagtggacgcctgcgcctcggactggcagagcagtcagtgctggccgccctcgcc
caggccgtgagcctcacaccccctggccaagaattccccccggccgtggtggatgctggg
aagggcaagacagcagaggccagaaagacgtggctggaggagcaaggcatgatcctgaaa
cagacgttctgcgaggtgccagatctggaccggatcgtccctgtgctgctggcacatggc
ctggagcagctgccggagcactgcaggctgagcccagggatccccctgaaaccaatgttg
gcccaccccacccggggcgtcggcgaggtcctgaaacgcttcgaggaggcagctttcacc
tgcgagtacaaatacgatggacagagggctcagatccaccttctggaagggaatcaggag
gacaacacaggaaggtaccccgacgtcatcagccgcgtcccaaagattaaactcccatca
gtcacatccttcattctggacactgaagccgtggcttgggaccaggaaaagaagcagatc
cagccattccaagtgctcaccacccgcaaacgcaaggaggtggacgcagcggagatccag
gtgcaggtgtgtttgtacgccttcgacctcatctacctcaatggagagtccctggtacgt
gagcccctctcccgacgccgccagctgctccgggagaacttcgtggagacggagggcgag
tttgtcttcgccacctccctggacaccaaggacacggagcagatcgctgagttcctggag
cagtcggtgaaagactcatgcgaggggctgatggtgaagaccctggacaccgatgccacc
tacgagatcgccaagagatcgcacaactggctcaagctgaagaaggactaccttgacggc
gtgggcgacaccctggacctcgtggtgatcggcgcctacctgggccgggggaagcgggcc
ggccggtacgggggcttcttgctggcctcctacgacgaggagagcgaggagctgcaggcc
atatgcaagctggggactggcttcagtgacgaagagctggaagagcatcaccagagcctc
caggccctggtgctgcccgccccacgcccctatgtccgggcagacggcgccgtgaccccc
gaccactggctggaccccagcgccgtgtgggaggtcaagtgcgccgacctctccctctcc
cccatctaccccgctgcccggggcctggtggacagcgagaagggcatctccctgcgcttc
ccgcggtttctgcgcgtccgggaggacaagaagccggagcaggccaccaccagtgcgcag
gtggcctgtctgtacaggaagcaaagtcagattcagaaccagcacggcgcagagccggac
tccgagccggaggatttctactag

DBGET integrated database retrieval system