KEGG   Camelus dromedarius (Arabian camel): 105099069
Entry
105099069         CDS       T04642                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk04530  Tight junction
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05219  Bladder cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105099069 (ERBB2)
   04012 ErbB signaling pathway
    105099069 (ERBB2)
   04066 HIF-1 signaling pathway
    105099069 (ERBB2)
   04020 Calcium signaling pathway
    105099069 (ERBB2)
   04151 PI3K-Akt signaling pathway
    105099069 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105099069 (ERBB2)
   04520 Adherens junction
    105099069 (ERBB2)
   04530 Tight junction
    105099069 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105099069 (ERBB2)
   05206 MicroRNAs in cancer
    105099069 (ERBB2)
   05205 Proteoglycans in cancer
    105099069 (ERBB2)
   05230 Central carbon metabolism in cancer
    105099069 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105099069 (ERBB2)
   05226 Gastric cancer
    105099069 (ERBB2)
   05219 Bladder cancer
    105099069 (ERBB2)
   05215 Prostate cancer
    105099069 (ERBB2)
   05213 Endometrial cancer
    105099069 (ERBB2)
   05224 Breast cancer
    105099069 (ERBB2)
   05223 Non-small cell lung cancer
    105099069 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105099069 (ERBB2)
   01524 Platinum drug resistance
    105099069 (ERBB2)
   01522 Endocrine resistance
    105099069 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105099069 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105099069 (ERBB2)
   04090 CD molecules [BR:cdk04090]
    105099069 (ERBB2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105099069 (ERBB2)
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   105099069 (ERBB2)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   105099069 (ERBB2)
CD molecules [BR:cdk04090]
 Proteins
  105099069 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ArsP_1
Other DBs
NCBI-GeneID: 105099069
NCBI-ProteinID: XP_031324058
LinkDB
Position
16
AA seq 1255 aa
MELAAWCRWGLLLALLPSGAAGTQVCTGTDMKLRLPASPETHLDMLRYLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLIAHNQVSRVPLQRLRIVRGTQLFEDNYALAVLDNA
DLLESATPAVGATPGGLQELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQPA
LMLIDTNRSRDCPPCSPACKASHCWGESSEDCQSLTGTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFTGCKKIFGSLAFLPESFEGDPASNTGPLQPEQLRVFESLEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRILHEGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNAHLCFVHTV
PWDQLFRNPHQALLHSANRPEDECVGKGLTCHSLCAHGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGVPREYVKDRHCLPCHPECQPQNGSVTCSGSEADQCVACTHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLAVVMGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPALGAGGTAHRRHRSTSTRSGGGELMLGLEPSEEEPPKSPLAPSEG
AGSDVFDGDLGMGAAKGLQTLPQHDSSPLQRYSEDPTGPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPLPPSRPAGATLERPKTLSPGKNGVVKDVFAFGAAVENPEYLAPQ
GRAAPQSRPSPAFSPAFDNLYYWDQDPSERGAPPSTFEGTPTAENPEYLGLDAPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccctccggagcc
gcgggcactcaagtgtgcaccggcacggacatgaagctgcggctcccagccagtcccgag
acccacctggacatgctccgctacctctaccagggctgtcaggtggtacagggtaacctg
gagctcacctacctgcccgctaacgccagcctctccttcctgcaggatatccaggaggtg
cagggctacgtcctcatcgctcacaaccaggtgagtcgggtcccactgcagaggctgcga
atcgtgcgaggcacccagctctttgaggacaactacgccctggctgtgctggacaatgca
gaccttctggaaagtgccacccctgctgtaggggccaccccaggagggctacaggaactg
cagctgcgaagcctcacagagatcctgaagggaggggtcctgatccagcgaaacccccag
ctttgctaccaggacacgattttgtggaaggacatcttccacaagaacaaccagccggcc
ctcatgctgatagacaccaaccgctcgcgggactgcccaccctgttctccagcttgtaaa
gcttcccactgctggggagaaagttccgaggactgtcagagcttgacaggaaccgtctgt
gccagtggctgtgcccgctgtaagggtccgcagcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggcatctgtgagctgcattgcccggctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttatacctttggtgccagctgtgtgaccgcctgtcct
tacaactacctgtctacggacgtgggatcctgcactctggtttgtcccctgaacaaccaa
gaggtgacagccgaggatggaacccagcgatgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcagtcaccagtgccaat
atccaggagtttaccggctgcaagaagatctttgggagcctggcatttctgccagagagc
tttgaaggggacccagcctccaacactggccccctccagcctgagcagctcagagtgttt
gagtctctggaggagatcacaggttacctgtacatctcagcatggccagacagcctgcct
gacctcagtgtcttccagaacctgcgagtaatccggggacgaattctgcatgagggtgcc
tactcgctgaccctgcaagggctgggcatcagctggctggggctgcgctcactgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccacctctgcttcgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgctaaccggcca
gaggatgagtgcgtgggcaagggcctgacctgccactcgctgtgtgcccatgggcattgc
tggggtccgggacccacccagtgtgtcaactgcagccagttccttcggggtcaggagtgc
gtggaggaatgccgagtactgcagggggtcccccgggagtacgtgaaggacaggcactgt
ctgccgtgccaccccgagtgtcagccccagaacggctcggtgacctgctctggctcggag
gctgaccagtgtgtggcttgcacccactacaaggatcctccattctgcgtggctcgctgc
cccagtggtgtgaagcctgacctctcgttcatgcccatctggaagttcccagatgaggag
ggcacgtgccagccgtgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgctgagcagagagccagccctgtgacgtccatcattgccgctgtggtgggc
attctgctggccgtagtcatggggctggtcttcggcatcctaattaagcgaaggcggcag
aagatccggaagtacacgatgcggaggctgctgcaggaaaccgagctggtggagcccctg
accccaagcggagcgatgcccaatcaagctcagatgcggatcttgaaagagacggagctg
aggaaggtgaaggtgcttggatccggagctttcggcacagtctacaagggcatctggatc
cctgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggatgaagcatatgtgatggctggagtaggctcccca
tatgtgtcccgcctcctgggcatttgcctgacatccacggtgcagctggtgacacagctc
atgccctacggctgcctcctggaccacgtccgagaacaccgcgggcgcctgggctcccag
gacctgttgaactggtgtgtgcagattgccaaggggatgagctacttggaggatgtgcgg
cttgtgcacagggacctggctgcccgcaatgtgctggtcaagagtcccaaccacgtcaag
attacagactttgggctggctcggctactggacattgatgagacggagtaccacgcagat
gggggcaaggtgcccatcaagtggatggcattggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttatgatggaatcccagcccgggagatccctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggaattggtggccgaattctcccgcatggcc
agggacccccagcgttttgtggtcatccagaatgaggacttgggccctgccagccctttg
gacagcaccttctaccgctcactgctggaggatgacgacatgggggatctggtggatgct
gaggagtacctagtaccccagcagggcttcttctgcccagaccctgccctgggcgctggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgatg
ctggggctggagccctctgaggaggagccccccaagtctccactggcaccttcagaaggg
gctggctctgatgtatttgacggcgacttgggaatgggggcagccaaggggctacagacc
ctcccccagcatgactccagccctctacagcggtacagtgaggaccccacaggacccctg
cctcctgagaccgatggctacgttgcccctctgacctgcagcccccaacccgaatacgtg
aaccagccagaggttcgaccacagccaccctcacccctagagggtcctctgcctccttct
cgacctgctggtgccactctggaaaggcccaagactctttccccagggaagaatggcgtt
gtcaaagacgtttttgcctttggggctgctgtggagaaccctgagtacttggcaccccaa
ggcagggctgcccctcagtctcgcccttctccagccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggcgctccacccagcacctttgaagggacc
cctacagcagagaaccccgagtacctgggtctggacgctccagtatga

DBGET integrated database retrieval system