KEGG   Camelus dromedarius (Arabian camel): 105099111
Entry
105099111         CDS       T04642                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2 isoform X1
  KO
K04387  interleukin 1 receptor type II
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04640  Hematopoietic cell lineage
cdk05146  Amoebiasis
cdk05166  Human T-cell leukemia virus 1 infection
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105099111 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105099111 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105099111 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    105099111 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105099111 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105099111 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105099111 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cdk04050]
    105099111 (IL1R2)
   04090 CD molecules [BR:cdk04090]
    105099111 (IL1R2)
Cytokine receptors [BR:cdk04050]
 Interleukin receptor families
  IL1 receptor family
   105099111 (IL1R2)
CD molecules [BR:cdk04090]
 Proteins
  105099111 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Ig_5 Ig_4 Izumo-Ig G6B Stevor
Other DBs
NCBI-GeneID: 105099111
NCBI-ProteinID: XP_010990202
LinkDB
Position
28
AA seq 423 aa
MRSCRVWGAGPEGSTSCVLQKFLGAVFILCMLVTGVSAFIIQPEERTVAAGNCQFRGKHV
KTRVMLEGEPVAIRCPQLLYWDDASAHINMTWRKNESAVTVPGEEEARVWVQDGVLWIVP
ASRGDSGTYTCTLRNASYCDEMSVELRVLEKTEVSRPLISYPQILPLSSSGMLVCPDLSE
FIRNKTDVKIQWYKDSVPLEQDNKKFLSVKVTSLLMNSVSEEDAGYYSCVMTFAHGGKQY
SITRNIKVRVNKREEAIPVIISPQETISASLGSRLTIPCVVFLGAGMPVTTMLWWMANST
QVKDAYQGGRVTEGPRKEYSQNNENYIEVPLIFDPVIREDLHTNYKCVVSNTAHFQTLRT
TVKEAAATFSWGIALAPLSLIILVLGGIWMHRRCKHRTRKACGLLELKTGHQESAPCKLK
EIK
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgcggagctgcagggtgtggggtgctggacctgagggctccacttcctgtgtcctccag
aagtttttgggggcggtgttcatcttgtgcatgttggtaaccggtgtttctgccttcatc
attcagccggaggaacgcacagtggctgcgggaaactgccaatttcgtggcaagcatgtc
aaaaccagagtcatgttggaaggggagcctgtggccataaggtgtccccagctgctgtac
tgggacgatgccagcgcccacatcaacatgacgtggaggaaaaacgagtccgctgtgaca
gtcccgggggaagaagaggcacgagtgtgggtccaggacggtgtcctctggatcgtgccg
gcctcgcggggggactccggcacctacacctgcactctcagaaatgcctcttactgtgat
gaaatgtctgtggagctcagggttcttgagaagacggaggtttcccggcccctcatctcc
tacccgcagatcctgcccctgtcatcctctgggatgctggtttgccctgatctgagtgaa
ttcatccgaaacaaaactgacgtgaagattcaatggtacaaggattccgtcccgttggaa
caagacaacaagaagtttctaagtgtgaaggtaacttcgttactcatgaacagtgtgtct
gaggaggatgcgggctattacagctgcgtcatgacgttcgcccatggaggcaagcaatac
agcatcaccaggaacatcaaagtccgcgtcaacaaaagagaagaggcaattcctgtgatc
atctccccccaagagaccatatcagcttcgctggggtcgagactgacaatcccgtgcgtg
gtgtttctgggggctggcatgcctgtgaccaccatgctgtggtggatggccaacagcacc
caagtcaaggatgcctaccaggggggccgtgtgaccgaggggccgcgcaaggagtactca
cagaataatgagaactacattgaagtgccactgatttttgacccagtcatcagagaggat
ttgcacaccaattataaatgtgttgtctctaatacggcgcatttccagacgctacgcacc
acagtcaaagaagcagctgccacgttctcctggggaattgcgctggcccccctgtccctc
ataatcttggttttggggggaatatggatgcacagacggtgtaagcacagaacaagaaaa
gcctgtggtttgttggagttaaagactggccatcaagaatccgctccatgtaaattaaag
gaaataaaatag

DBGET integrated database retrieval system