KEGG   Camelus dromedarius (Arabian camel): 105099222Help
Entry
105099222         CDS       T04642                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04110  Cell cycle
cdk04213  Longevity regulating pathway - multiple species
cdk04330  Notch signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05016  Huntington disease
cdk05034  Alcoholism
cdk05165  Human papillomavirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    105099222 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105099222 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105099222 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105099222 (HDAC2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    105099222 (HDAC2)
   05202 Transcriptional misregulation in cancer
    105099222 (HDAC2)
   05203 Viral carcinogenesis
    105099222 (HDAC2)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    105099222 (HDAC2)
  09164 Neurodegenerative diseases
   05016 Huntington disease
    105099222 (HDAC2)
  09165 Substance dependence
   05034 Alcoholism
    105099222 (HDAC2)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    105099222 (HDAC2)
   05165 Human papillomavirus infection
    105099222 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105099222 (HDAC2)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105099222 (HDAC2)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     105099222 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     105099222 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105099222 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    105099222 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 105099222
NCBI-ProteinID: XP_010990324
LinkDB All DBs
Position
Un
AA seq 528 aa AA seqDB search
MRMPWSRPGEPMRKRVGARSSSSSSRRRSRSPEAAVAGEPMAYSQGGGKKKVCYYYDGDI
GNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSI
RPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGL
HHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFH
KYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVL
QCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVA
LDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGV
QMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKK
GAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGAKSEQLSNP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgccctggagcaggcccggcgagcccatgaggaagcgcgtcggcgccaggagc
agcagcagcagcagcaggaggaggagccggagcccggaggcggccgtggccggggagccc
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcatagaatccgcatgacccat
aacttgctgctaaattatggcttatatagaaagatggaaatatataggccccataaagct
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatggactctttgaattttgtcaactttcaactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatatagtgcttgcc
atccttgaattactaaaatatcatcagagagtcttatatattgacattgatatccatcat
ggtgatggcgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgctggaaagggc
aaatactatgctgtcaattttccaatgagagatggaatagatgatgaatcatatgggcag
atatttaagcctattatctcaaaagtgatggagatgtatcaacctagtgctgtggtgtta
cagtgtggtgcagactcactgtctggcgatagacttggttgcttcaatctgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggcggatacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaatatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttacctcatgcacctggcgtc
caaatgcaagctattccagaggatgcagttcatgaagacagtggtgatgaagatggagaa
gatccagacaagagaatttctattcgagcttcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaggctagaatcgaagaagacaagaaggaaacggaggacaaaaaagcagat
gttaaggaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system