KEGG   Camelus dromedarius (Arabian camel): 105099289Help
Entry
105099289         CDS       T04642                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk01100  Metabolic pathways
cdk04064  NF-kappa B signaling pathway
cdk04370  VEGF signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04668  TNF signaling pathway
cdk04723  Retrograde endocannabinoid signaling
cdk04726  Serotonergic synapse
cdk04913  Ovarian steroidogenesis
cdk04921  Oxytocin signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk05140  Leishmaniasis
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05204  Chemical carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105099289 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    105099289 (PTGS2)
   04064 NF-kappa B signaling pathway
    105099289 (PTGS2)
   04668 TNF signaling pathway
    105099289 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105099289 (PTGS2)
   04657 IL-17 signaling pathway
    105099289 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    105099289 (PTGS2)
   04913 Ovarian steroidogenesis
    105099289 (PTGS2)
   04921 Oxytocin signaling pathway
    105099289 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    105099289 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    105099289 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    105099289 (PTGS2)
   05206 MicroRNAs in cancer
    105099289 (PTGS2)
   05204 Chemical carcinogenesis
    105099289 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    105099289 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    105099289 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105099289 (PTGS2)
   05165 Human papillomavirus infection
    105099289 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    105099289 (PTGS2)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     105099289 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 105099289
NCBI-ProteinID: XP_010990402
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCGAANPCCSNPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TKIKLFLKPTPNTVHYILTHFKGIWNIVNNISFLRNMIMKYVLISRSHLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGRKELPDSKEVVEKLLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLNHGVDLNHVYGESLERQHKLRLFKDGKMKY
QVIGGEVYPPTVKDTQVKMIYPPHVPEHLQFAVGQELFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFQIGDQEYNYQQFIYNNSILLEHGVTQFVESFSRQIAGRV
AGGRNLPAAVQTVAKASIDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDVMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctctgcgccgccctggcgctctgcggtgcagcaaatcct
tgctgttccaacccatgccagaatcgaggtgtatgtatgagcgtaggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacccgaatttctg
acaaaaataaaattattcctgaaaccgactccaaacacagtgcactacatacttacccat
ttcaagggaatctggaacattgtcaataacatttccttcctgcgaaatatgattatgaaa
tatgtgttgatatcaagatcacatctgattgacagcccaccaacttacaatgcacactat
ggctataaaagctgggaagccttttctaatctctcctattatacaagagctcttcctcct
gtggctgacgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaattacttctgagaagaaagttcatccctgacccccagggtaca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgaaccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaattacgtcttttcaaggatggaaaaatgaaatat
caggtaattggtggagaggtgtatcctccaacagtcaaagatactcaggtcaagatgatc
taccctcctcatgttcctgaacacctgcagtttgctgtggggcaggagctctttggtctg
gtgcctggtctgatgatgtacgccacaatctggctgcgggaacacaatagagtgtgtgat
gtgcttaagcaggagcatccagaatgggatgatgagcggttgttccagacgagcaggctc
atactgataggagaaactattaagattgtgattgaagactatgtgcagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctacttttcaaccaacaattccagtaccaa
aaccgtattgctgctgaatttaacacactctaccactggcatccccttctgcctgacagc
tttcagattggtgaccaagagtacaactatcagcagtttatctacaacaactctatctta
ctagaacatggtgtcacccagtttgttgaatcattcagcaggcaaattgctgggagggtt
gctggtggtaggaatctaccagctgcagtacagacagtagcaaaggcctcaatcgaccag
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgatttctactgaagccc
tatgaatcatttgaagaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tatggtgacattgatgtcatggaactgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggggagaccatggtagaagctggagcaccattctccttgaaaggactg
atgggtaatcctatatgttctcctgagtactggaagcccagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataatgtgaaaggc
tgtccttttacctcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagttcttcccactctggactagatgatatcaaccccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system