KEGG   Camelus dromedarius (Arabian camel): 105100030
Entry
105100030         CDS       T04642                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X5
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00230  Purine metabolism
cdk01100  Metabolic pathways
cdk01522  Endocrine resistance
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04114  Oocyte meiosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04270  Vascular smooth muscle contraction
cdk04371  Apelin signaling pathway
cdk04540  Gap junction
cdk04611  Platelet activation
cdk04713  Circadian entrainment
cdk04714  Thermogenesis
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04727  GABAergic synapse
cdk04740  Olfactory transduction
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04913  Ovarian steroidogenesis
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04921  Oxytocin signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk04970  Salivary secretion
cdk04971  Gastric acid secretion
cdk04972  Pancreatic secretion
cdk04976  Bile secretion
cdk05032  Morphine addiction
cdk05163  Human cytomegalovirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105100030 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    105100030 (ADCY3)
   04371 Apelin signaling pathway
    105100030 (ADCY3)
   04020 Calcium signaling pathway
    105100030 (ADCY3)
   04072 Phospholipase D signaling pathway
    105100030 (ADCY3)
   04024 cAMP signaling pathway
    105100030 (ADCY3)
   04022 cGMP-PKG signaling pathway
    105100030 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105100030 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105100030 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105100030 (ADCY3)
   04062 Chemokine signaling pathway
    105100030 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    105100030 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    105100030 (ADCY3)
   04912 GnRH signaling pathway
    105100030 (ADCY3)
   04913 Ovarian steroidogenesis
    105100030 (ADCY3)
   04915 Estrogen signaling pathway
    105100030 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    105100030 (ADCY3)
   04921 Oxytocin signaling pathway
    105100030 (ADCY3)
   04926 Relaxin signaling pathway
    105100030 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    105100030 (ADCY3)
   04918 Thyroid hormone synthesis
    105100030 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    105100030 (ADCY3)
   04916 Melanogenesis
    105100030 (ADCY3)
   04925 Aldosterone synthesis and secretion
    105100030 (ADCY3)
   04927 Cortisol synthesis and secretion
    105100030 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105100030 (ADCY3)
   04270 Vascular smooth muscle contraction
    105100030 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    105100030 (ADCY3)
   04971 Gastric acid secretion
    105100030 (ADCY3)
   04972 Pancreatic secretion
    105100030 (ADCY3)
   04976 Bile secretion
    105100030 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105100030 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    105100030 (ADCY3)
   04727 GABAergic synapse
    105100030 (ADCY3)
   04725 Cholinergic synapse
    105100030 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    105100030 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    105100030 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    105100030 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    105100030 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    105100030 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105100030 (ADCY3)
   04714 Thermogenesis
    105100030 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105100030 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    105100030 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    105100030 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105100030 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105100030 (ADCY3)
   05163 Human cytomegalovirus infection
    105100030 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105100030 (ADCY3)
Enzymes [BR:cdk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105100030 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 105100030
NCBI-ProteinID: XP_010991252
LinkDB
Position
15
AA seq 1145 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDADRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAMASVGLVLDII
LFVLCKKGLLPNRVTRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGMRLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTAAQNGLNGSALPNGAPPSSKPSSPALIGTKEPDGSIHT
SGSTSEEPEEQDAPADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCAALVEILIDPWLMTN
YVTFVVGEVLLLILTVCSMAAIFPQAFPKKLVAFSTWIDRTRWARNTWAMLAVFILVMAN
VVDMLSCLQYYSGPSNSTAGVQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIHAWRPIFDEYDHRRFQEHDFPTVALEKMQVFSSPGLNGTDRLPLVPSK
YSMTAMVFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccaaggacccagggcttctctgatcccgagtactccgccgagtactccgccgagtac
tccgtcagtctgccctctgacgctgaccgaggggtgggccggacccatgaaatctctgtc
cggaactcgggatcctgcctctgcctgccccgcttcatgcgcctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttcaaaaggcagcgccatgagacgctgctggtg
ctggtggtcttcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagcgacaagctggctcctctggccatggccagtgttgggctggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctccccaacagggtcacccggaaggtggtcccc
tacctgctgtggctgctgataacagcccagatcttctcctacctgggcctgaacttctcc
cgtgcccacgctgccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgttgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgtgtcgtg
cacaccctcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaaggggatg
cggttgctgagggagatcctggccaacgtcttcctttacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggctgatgagatgctgaaggacatgaagaaggacgagagc
caaaaggaccagcaacagttcaacaccatgtacatgtaccgccacgagaatgtcagcatc
ctctttgctgacatcgtgggcttcacccagctgtcttcggcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcggccaaataccaccag
ctccggattaagatcctgggtgactgttactactgcatctgcggcctgcctgactaccgg
gaggatcacgccgtctgctccatcctcatggggcttgccatggtggaggccatctcgtat
gtgcgggagaagacgaagaccggggtggacatgcgtgtgggggtgcacacaggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaagccggcggcatcccagggcgcgtgcacatctcccagagcacc
ttggactgcctgaaaggagagttcgatgtggagccaggcgatgggggcagccgctgcgat
tacctggacgagaaaggcattgaaacctaccttatcattgcgtccaagccagaggtgaag
aagacggccgcccaaaatggcctcaatggctcagccttgccgaatggagcgccgccatcc
tcaaagcccagctcccctgccctcatcgggaccaaggagcccgacgggagcatccacact
agcggctccacgtcggaggagcctgaggagcaggatgccccagccgacaacccctcattc
cccaacccccgccggaggctgcgccttcaggacctggctgaccgcgtggtggacgcctct
gaggacgagcacgagctcaaccagctactcaacgaggccctgctggagcgggagtccgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggaaaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgtgcggccctggtggagattctcatcgacccctggctcatgacaaac
tatgtgacttttgtggttggggaggttctgctcctgatcctgacagtctgctccatggct
gccatctttccacaggcctttcccaagaagctcgtggccttctcgacttggatcgaccgg
acccgctgggccaggaatacctgggccatgctggccgtcttcattctggttatggcaaac
gtcgtggacatgctcagctgtctccagtactactcggggcccagcaacagcacggcgggg
gtgcaggtggaggacggctgcgtggagaatcccaagtactacaactacgtggctgtgctg
tccctcattgccaccatcatgctggtgcaggtcagccatatggtgaagctcacgctcatg
ttgctcatcgccggggccgtggccgtcatcaacatccacgcctggcgccccatcttcgat
gaatacgaccacagacgtttccaggaacatgactttccgacagtcgccttagagaagatg
caggtgttctccagccctgggctcaatggcactgacaggctgcccctggtgccttccaag
tactccatgacggccatggtcttcatcatgatgctgagcttctactacttctcccgccat
gtggagaaactggcacggacattgttcctgtggaagattgaggtccacgaccagaaggaa
cgtgtctacgagatgcggcgttggaacgaggccttggtcaccaacatgctgcctgagcat
gtggcacgtcacttcctggggtccaagaagagagatgaggagctgtacagtcagtcttac
gatgagattggagtcatgtttgcctccctgcccaacttcgctgacttctacacagaggag
agcatcaataacgggggcatcgagtgtctgcgcttcctcaacgagatcatctcagatttt
gactctctcttggacaaccccaaattccgggtcatcaccaagatcaaaaccatcggcagc
acctacatggcagcttcaggagtcacccccgatgtcaacaccaacggcttcaccagctcc
aacaaggaggagaagtcggacaaggagcgctggcagcacctggcggatctggcggacttt
gcgctcgccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcatcggcatgaataaaggaggggtgctggctggggtcattggagcccggaaacca
cactatgacatctggggcaatacagtcaacgttgccagcaggatggagtccacaggggtc
atgggcaacattcaggtggtggaagaaacccaagtgatcctccgggagtacggcttccgc
tttgtgaggagggggcccatctttgtgaaagggaagggggagctgctaaccttcttcctg
aagggccgcgacaagccagccgccttcccgaacggctcttctatcacgctgccccaccag
gtagtggacaactcctga

DBGET integrated database retrieval system