KEGG   Camelus dromedarius (Arabian camel): 105100195Help
Entry
105100195         CDS       T04642                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X1
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
cdk04714  Thermogenesis
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105100195 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105100195 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    105100195 (CPT1C)
   04920 Adipocytokine signaling pathway
    105100195 (CPT1C)
   03320 PPAR signaling pathway
    105100195 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    105100195 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105100195 (CPT1C)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105100195 (CPT1C)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105100195 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 105100195
NCBI-ProteinID: XP_010991477
LinkDB All DBs
Position
9
AA seq 803 aa AA seqDB search
MAEAHQAVDFRPSLTSDPGKVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKESLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDEAFDWTAALAQEFLRLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLNRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVQKDHIRHLRDSRHVAVFHRGRFFRVGTHSQSGLLSPRALEQ
QFQRILDDPSPSCPHEEHLAALTAAPRDMWAQVRRSLKTQAEEALEAVEGAAFFVSLDSE
PAGVSREDPAASLDAYAHALLAGRGYDRWFDKSFSLIVFSNGRLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSTDGHCKGDPDPTLPQPQRLYWDLPDKIHLSISLALRGAKTLSGN
IDCHVFPFSHFGKSFIKCCHLSSDSFIQTALQLAHFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREACNFVKAMEDKEKTDAQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYIV
SQLLHLQSPFLDQVHSEQWQLATSQIPVQQIHLFDVQNYPDYVSSGGGFGPADDHGYGVS
YIFTGDEAITFHISSKKSSTRTDSHRLGQHIKDALLDVAALFQEGQRLKRRCRGSGEEDS
EHSCGSLPCHTGGSRAPMTPTNF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaagccgtggacttccgaccttcgctgacttcggacccggggaaa
gtggagctcagtgcccccgtgttgcaggagatctacctctccggactgcgctcgtggaaa
aggcatctctctcgtttctggaacgactttctcacaggtgtgttccctgcgagccccctc
agctggctgttcctcttcagtgcaatccagcttgcctggttcctccaactggatccttcc
ctaggactgatggagaaaatcaaagagtcactgccagactggggtggacagcaccacagg
cttcggggggtcctggcagctgcgctgtttgcttcatgtctgtggggagctctgatcttc
acgcttcatgtggccctgaggctacttctgtcctaccacggctggctccttgaaccccac
ggagccatgtcctcacccaccaagacctggctggccctggtccgcatcttctccggccgc
cacccaatgctcttcagttaccaacgctccctgccgcgccagcccgtgccctccgtgcag
gacaccgtgcgcaagtatctggagtctgtccgacccgtcctctcagacgaggccttcgac
tggactgcggccctagcgcaggaattcctgaggctgcaggcatcgctgctgcagtggtac
ctacagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaatttgtg
tacctgcgctcccggaactcactgatggtgaacagcaactattatatgatggacttcctg
tacgtcacgcccaccccggtgcaggcagctcgggcggggaacgccgtccatgccctcctt
ctgtaccgccaccgcctgaaccgccaggagatcctgccaactctgctgatgggaatgagg
ccattatgctctgctcagtatgagaagatattcaacaccacacgaatcccaggggtccaa
aaagaccacattcgccacctccgtgacagccgacacgtggccgtcttccaccggggccga
ttcttccgcgtggggacccactcccaaagcggcctgctatccccgcgggccctggagcag
cagttccagcgaatcctggatgacccctccccctcctgcccccacgaggagcatctggcc
gccctgaccgctgctcccagggacatgtgggctcaggtgcgaaggtccctgaagacccag
gccgaggaagccctagaggccgtcgaaggtgccgctttctttgtatcactggactccgag
cccgcgggggtctccagggaggaccccgcagcctccttagatgcctacgcccacgccctg
ctggccggcaggggctacgaccgctggtttgacaaatccttctcgctgatcgtcttctcc
aacgggaggctgggcctcagtgtagagcactcatgggccgactgccccatctcagggcac
atgtgggagttcactctggccacagaatgctttcagctgggctactcaacagatgggcac
tgcaagggggatcctgaccccacgctgcctcagccccagcggctgtactgggaccttcca
gacaagatccatctatccatctctctagccctgaggggagccaagaccttgtctggaaac
atcgactgccacgtcttccccttctcccactttggcaagagcttcataaaatgctgtcac
ctctcttcagacagtttcatccagacagccttgcagctggcccacttccgggacaggggt
cagttctgcctgacttatgagtcaaccatgactcgcttgttcctggaaggccggaccgag
acggtacgttcttgcacgagggaggcctgcaactttgtgaaagccatggaggacaaagag
aagacagacgcacagtgcctcgccctgttccgcctggcggtggacaagcaccaggctctg
ctgaaggcagcgatgagcggacagggggttgaccgtcacctctttgctctctacatcgtg
tcccaactcctccacctacaatcacccttcctggaccaggttcactcggagcagtggcag
ctggccacgagccagattcctgttcagcaaatccacctgtttgatgtccagaattacccc
gactacgtttcctctggtggtggatttgggcctgccgatgaccacggttatggggtttct
tacatcttcacgggagacgaggctatcaccttccacatctccagcaaaaagtcaagcaca
agaacggactcccaccggctggggcaacacatcaaggatgcattgttggacgtggccgcc
ctgttccaggaggggcagcgtcttaagcgccggtgcagagggtcaggggaggaggactcg
gagcacagctgtggctctctcccctgccacactgggggctctcgggcacccatgacaccc
accaacttttga

KEGG   Camelus dromedarius (Arabian camel): 105104399Help
Entry
105104399         CDS       T04642                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
cdk04714  Thermogenesis
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
cdk04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105104399 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105104399 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    105104399 (CPT1A)
   04920 Adipocytokine signaling pathway
    105104399 (CPT1A)
   03320 PPAR signaling pathway
    105104399 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    105104399 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105104399 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105104399 (CPT1A)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105104399 (CPT1A)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105104399 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 105104399
NCBI-ProteinID: XP_031304449
LinkDB All DBs
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDSTSSMSSRTKNVVSGVLFGTGLWVALIF
TMRYSLKVLLSYHGWMFLEHGKISRATKIWMCMVKIFSGRKPMLYSFQTSLPRLPVPAVQ
DTVNRYLESVRPLMKEADFQRMTALAQDFAVSLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYVLPTHIQAARAGNGIHAILLYRRKLDREEIKPIFLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVFHRGRYFKVWLYHDGRLLKPREIE
QQMQRILDDPSEPQAGEEKLAALTAGERVPWARCRQAYFGQGKNKQSLDAVEKAAFFVTL
DETEQGYRKEDVETSMDSYAKSLLHGRCFDRWFDKSFTFVVFKNGKMGMNAEHSWADAPI
AGHLWEYVMATDSFQLGYTEDGHCKGDTNPNIPYPTRLQWDIPEECQEVVEMSLSTATRL
ANDVDFHSFPFTTFGKGLIKKCRTSPDGFVQLALQLAHYKDMGKFSLTYEASMTRLFREG
RTETVRSCTTESCNFVLAMVDPTQTVEQRLNLFKIASKKHQHLYRLAMTGSGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPPQQVELFNLERNPEYVSSGGGFGPVADDGY
GVSYILVGDDLINFHISSKFSCPETDSHRFGKHLKQAMADIITLFGFSANSNK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctcaccaagccgtggccttccagttcacggtcactcctgatgggatcgac
ctccggctgagccatgaggccctcaagcagatctgtctgtccggacttcactcctggaag
aagaaattcatcagattcaagaatggcatcatcaccggcgtgtacccggcaagtccctcc
agttggctcatcgtggttgtgggcgtgatgtcaacgatgtatgccaagatcgacccctct
ttgggaataattgcaaaaatcaatcggacccttgactcaaccagctccatgtctagccgg
acaaagaacgtggtcagcggcgtcctgtttggcacgggcctgtgggtggccctcatcttc
accatgcgctactccctgaaggtgctgctgtcctaccacggctggatgttcctcgagcac
ggcaagatcagccgcgccaccaaaatctggatgtgtatggtcaagatcttttcaggccgc
aaacccatgctatacagcttccagacgtctctgccccgcctgccggtcccagccgtgcaa
gacactgtgaacaggtatctggaatccgtgaggcctcttatgaaggaagcagacttccag
cggatgacggctctggcccaagattttgctgtcagtcttggacccagactgcagtggtat
ttgaagttgaaatcctggtgggctacaaattatgtgagtgactggtgggaggagtatatc
tacctccgaggccggggtccgctgatggtgaacagcaactactacgcgatggatctgctg
tacgtcttacccacgcacatccaggcggcgagagcgggcaacggtatccacgccatcctg
ctttacagacgcaaactggaccgggaggaaatcaaaccaatttttcttctggggtctaca
attccgctctgctctgcccagtgggagcggatgttcaatacgtcccggatcccaggagag
gaaacagacaccatccagcacatgcgggacagcaagcacatagttgtgttccacagaggg
cgctacttcaaggtctggctctaccacgacggcaggctgttgaagccccgagaaatcgaa
cagcagatgcagaggattttggacgacccgtccgagccccaggctggggaggagaagctg
gcggccctcactgcgggagagagagtaccctgggccaggtgtcgccaagcctattttgga
cagggcaaaaataagcagtcccttgatgccgtggagaaagcagcgttcttcgtgacgttg
gacgaaaccgaacaaggatacaggaaggaagacgtggagacgtcgatggacagctacgcc
aagtctctgctgcacggcaggtgtttcgacaggtggtttgataagtcgttcacgtttgtc
gtcttcaaaaacgggaagatgggcatgaacgcagagcactcctgggccgacgcccccatc
gccggccacctttgggagtatgtcatggccactgacagcttccagctgggctacacggag
gacggacactgtaaaggggacaccaacccaaacattccataccccactcggctgcagtgg
gacatcccggaggagtgccaggaggttgtagagatgtccctgagcaccgcgacccgcctg
gccaacgacgtggacttccattcttttccgttcaccacctttggtaaagggctgatcaag
aagtgccggaccagcccggacggcttcgtgcagctcgccctgcagctggcccactacaag
gacatgggcaaattctccctcacctatgaggcctccatgacccggctcttccgagaaggg
cgaacggagacggtgcggtcctgcaccaccgagtcgtgcaactttgtgctggccatggtg
gaccccacgcagacggttgaacagaggctcaacttattcaagattgcatccaagaagcac
cagcatctctaccgcctggcgatgaccggctcggggattgaccgccatctcttctgcctc
tacgtggtgtccaaatacctggctgtcgactcccctttcctgaaggaggtcctatctgaa
ccttggagattatcaaccagccaaacccctccacagcaggtggagctctttaatttggag
aggaatccggagtatgtgtcgagcggagggggcttcggaccggttgctgacgatggttac
ggtgtgtcgtacattctcgtgggggatgacctcatcaattttcacatatcttccaagttc
tcgtgccccgagacagattctcaccgcttcgggaagcacttgaaacaagcaatggctgac
atcatcactttgttcggtttcagcgccaattccaacaagtaa

KEGG   Camelus dromedarius (Arabian camel): 105106153Help
Entry
105106153         CDS       T04642                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04152  AMPK signaling pathway
cdk04714  Thermogenesis
cdk04920  Adipocytokine signaling pathway
cdk04922  Glucagon signaling pathway
cdk04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105106153 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105106153 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    105106153 (CPT1B)
   04920 Adipocytokine signaling pathway
    105106153 (CPT1B)
   03320 PPAR signaling pathway
    105106153 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    105106153 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105106153 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105106153 (CPT1B)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105106153 (CPT1B)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105106153 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 105106153
NCBI-ProteinID: XP_031319438
LinkDB All DBs
Position
12
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFRLSREALKQIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVITTVGSSYCNVDISRGLVCYIQRCLPERCGPYRTPQTRALLSMAVFSTGVWMMG
IFFFRQTLKLLLSYHGWMFEMHGKTSCFTKVWAICVRLLSSRRPMLYSFQASLPKLPVPS
VPATVHRYLESVQHLLDDEEYCRMEVLAKEFQEKTAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRTPLMVNSNYYVMDLVLVKNTDVQAARLGNAVHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDADVLQHLTDSRHVAVYHKGRFFKVWLYEGSHLLKPRDL
EMQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVA
LDEESHGYDPEDEASLSLYGKALLHGNCCNRWFDKSFTLIAFKNGQLGLNTEHAWADAPI
IGHLWEFVVGTDAFHLGYAETGHCLGKPNPLLAPPQRLQWDIPEQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTRESTAFVQAMVEGRHMKADLQDLFRKAAEKHQNMYRLAMTGAGIDRHLFCL
YVVSKYLGVSSPFLAEVLSEPWRLSTSQIAQFQIRMFDPNKYPNHLAAGGGFGPVADDGY
GVSYMIAGENTIFFHVSSKFSSSETNAQRFGNHIRQALLDIADLFQVPKADR
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggctgtggccttccagttcaccgtgaccccagaaggggtcgac
ttccggctcagtcgggaggccctgaaacagatctacctgtccggcatcaactcctggaag
aaacgcctgattcgcatcaagaatggcatcctcaggggcgtgtatcctggcagccccacc
agctggctggtcgtcgtcataacgacagtgggttcctcctactgcaacgtggatatttcc
agagggctagtctgttatatccagagatgtcttcctgagagatgtggcccctaccggacc
ccacagacccgggcacttctcagcatggctgtcttctccacgggggtctggatgatgggc
atcttcttcttccggcaaaccctgaaactgctgctttcctaccacggttggatgtttgag
atgcatggcaagaccagctgcttcaccaaagtctgggctatctgtgtccgccttctatcc
agtcggcgacccatgctctacagcttccaggcttctctgcccaagcttcccgtgcccagc
gtgccggccacagttcatcggtacctagagtctgtgcaacacttattggatgatgaggaa
tattgccgaatggaggtgctggccaaggaattccaggagaagactgcccccaggctgcag
aagtacctggtactcaagtcgtggtgggcaactaactatgtgagtgactggtgggaagag
tatgtctaccttcgaggcaggacccccctcatggtgaacagcaactattacgtcatggac
ttagtgcttgtcaagaacacagatgtgcaggcggcccgcctgggaaacgccgtccatgcc
atgatcatgtatcgccgtaaactggaccgtgaagagatcaagcctgtgatggcgcttggc
atcgtgcccatgtgctcctaccagatggagaggatgttcaacaccacccggatcccaggg
aaggacgcagacgtgctgcagcacctcacggacagcaggcatgttgctgtctaccacaag
ggccgcttcttcaaggtgtggctctacgaaggctcccacctgctcaagcctcgagacctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaga
ctggcggccctcactgctgggggaagggtggagtgggcgcaggcacgccaggccttcttc
agctctggcaagaacaaggccgcgctggatgccatcgagcgcgccgctttctttgttgct
ttggacgaggagtctcatggctatgaccccgaagacgaggccagcctcagcctgtatggc
aaggccctgctgcatggcaactgctgcaacaggtggttcgacaagtccttcacacttatt
gccttcaagaacggtcagctgggcctcaacacagaacacgcgtgggcagatgcccctatc
atagggcacctctgggagtttgttgtgggcactgacgccttccacctgggctacgcagag
actgggcactgtctgggtaaaccaaaccctttgctggcaccccctcagcggctgcagtgg
gacatccctgagcagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgctg
gcggacgatgtggagctgtactgcttccagttcttgcccttcggcaaaggcctcatcaag
aagtgccggaccagccccgatgcctttgtgcagatcgccctgcagctggcacacttccgg
gataggggcaagttctgcctgacctatgaagcctcgatgactagaatgttccgggaggga
cggactgagactgtacgttcctgtacccgcgagtccacagccttcgttcaggccatggtg
gaggggcgccacatgaaagcagacctccaagatctgttccggaaggctgccgagaagcac
cagaatatgtaccgcctggcaatgacgggggctgggattgaccggcacctcttctgcctt
tatgtggtctccaagtacctgggggtcagctcccctttcctggctgaggtgctctcagaa
ccctggcgtctctccaccagccagatcgctcaattccagatccgcatgtttgacccaaac
aagtaccccaatcacctggctgctggcggtggctttggccctgtagcagacgatggctac
ggggtttcctacatgatcgccggtgagaacaccatcttcttccatgtctccagcaagttc
tcaagttcagagacgaacgcccagcgctttgggaaccacatccgccaagctctgctggac
atcgctgatcttttccaagttcccaaggctgaccgctga

DBGET integrated database retrieval system