KEGG   Camelus dromedarius (Arabian camel): 105100371Help
Entry
105100371         CDS       T04642                                 

Definition
(RefSeq) platelet glycoprotein 4-like
  KO
K06259  CD36 antigen
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04145  Phagosome
cdk04152  AMPK signaling pathway
cdk04512  ECM-receptor interaction
cdk04640  Hematopoietic cell lineage
cdk04920  Adipocytokine signaling pathway
cdk04931  Insulin resistance
cdk04975  Fat digestion and absorption
cdk04979  Cholesterol metabolism
cdk05144  Malaria
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105100371
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    105100371
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105100371
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105100371
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105100371
   03320 PPAR signaling pathway
    105100371
  09154 Digestive system
   04975 Fat digestion and absorption
    105100371
   04979 Cholesterol metabolism
    105100371
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105100371
  09174 Infectious disease: parasitic
   05144 Malaria
    105100371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105100371
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105100371
   04090 CD molecules [BR:cdk04090]
    105100371
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    105100371
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105100371
CD molecules [BR:cdk04090]
 Proteins
  105100371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36
Motif
Other DBs
NCBI-GeneID: 105100371
NCBI-ProteinID: XP_010991675
LinkDB All DBs
Position
7
AA seq 472 aa AA seqDB search
MVCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIEKTIKKEVVLEEGTIAFKNWVKTGTE
VYRQIWIFDVQNPEEVAVNSSKIKVKQRGPYTYRVRYLAKEIIKQDSETHTVSFNQHKGA
IFEPSLSIGTENDTFTILNLAVAAAPHLYPSRFIQLILNAFVKSSKSSMFQKRTVKELLW
GYTDPFLNAVPYPISTTVGVFFPYNNTADGVYKVFTGKDNISKVAIIDTYKGKKTFSYWP
SYCDMINGTDAASFPPFIEKTRVLQFFSSDICRSMYAVFGAEINLKGIPVYRFILPSMVF
ASPLQNPDNHCFCTEKTISKNCTLYGVLDIGKCKGGRPVYISLPHFLHASPEIAKTIEGL
NPNEEEHSTYLDVEPITGFTLRAAKRLQINMLVKPAKNIEALKNLKQNYIVPILWINETG
TLGDKKAEMFRHQVTEKINLLGLVEMISLSVGVVMFITFIISYCTCRSKKVN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgaccgaaactgtgggctcatcgctggcgctgtcatcggtgcagtcctggct
gtgtttggaggtattctaatgccagttggagacctgctcattgagaagacaattaaaaag
gaagttgtccttgaagaaggtacaattgcttttaaaaattgggttaaaacaggaacagaa
gtttacagacagatctggatctttgatgtgcagaatccagaggaagtggcagttaacagc
agcaaaattaaagttaagcaaagaggtccttacacatacagagttcgttatctagccaag
gaaattataaagcaggactctgagacccacacggtctctttcaatcagcacaagggtgcc
atctttgaaccttcactatcaattggaacagagaatgacacatttaccatcctcaatctg
gctgtagcagctgcaccccacctctatccaagtagatttattcaactaatactcaatgca
tttgtgaaaagttcaaaatcttctatgtttcaaaagagaactgtgaaagaacttttgtgg
ggctatacagatccattcctgaatgcggttccataccctatttctaccacagttggtgtg
ttttttccttacaataatactgcagatggagtttataaagttttcaccggaaaagacaac
ataagcaaagttgccataattgacacatataaaggcaaaaagactttctcctattggcca
agttactgtgatatgattaatggcacagatgctgcctcatttccacctttcattgagaag
acccgggtattgcaattcttttcctctgacatttgcaggtcaatgtatgctgtgtttgga
gccgaaattaatctgaaaggaattcctgtgtatagatttattcttccatccatggttttc
gcatctccacttcaaaatccagacaaccactgtttctgcacagaaaaaactatatcaaaa
aactgtacattatatggtgtactagacattggcaaatgcaaaggtggaagacctgtatac
atttcacttcctcattttctacatgcaagtcctgaaattgcaaaaactattgaaggctta
aatccaaatgaagaagaacacagcacctatttagatgttgaacctataacaggattcact
ttacgagctgcaaaacggctacagatcaacatgttggtcaagccagcaaaaaacattgaa
gcattaaagaatctgaagcagaactatattgtgcctattctttggattaacgagactggc
acccttggtgataagaaggcagaaatgttcagacatcaagtgactgaaaaaataaacctc
cttggcctggtagaaatgatctcactgagtgttggtgtggtgatgtttattacttttatt
atttcatactgtacatgcagatcaaagaaagtaaattaa

KEGG   Camelus dromedarius (Arabian camel): 105100373Help
Entry
105100373         CDS       T04642                                 

Definition
(RefSeq) platelet glycoprotein 4
  KO
K06259  CD36 antigen
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04145  Phagosome
cdk04152  AMPK signaling pathway
cdk04512  ECM-receptor interaction
cdk04640  Hematopoietic cell lineage
cdk04920  Adipocytokine signaling pathway
cdk04931  Insulin resistance
cdk04975  Fat digestion and absorption
cdk04979  Cholesterol metabolism
cdk05144  Malaria
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105100373
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    105100373
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105100373
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105100373
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105100373
   03320 PPAR signaling pathway
    105100373
  09154 Digestive system
   04975 Fat digestion and absorption
    105100373
   04979 Cholesterol metabolism
    105100373
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105100373
  09174 Infectious disease: parasitic
   05144 Malaria
    105100373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105100373
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105100373
   04090 CD molecules [BR:cdk04090]
    105100373
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    105100373
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105100373
CD molecules [BR:cdk04090]
 Proteins
  105100373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD36 PorA
Motif
Other DBs
NCBI-GeneID: 105100373
NCBI-ProteinID: XP_031310633
LinkDB All DBs
Position
7
AA seq 472 aa AA seqDB search
MGCDRNCGLIAGAVIGAVLAVLGGILMPVGDMLIEKTIKKEVVLEEGTIAFKNWVKTGTE
VYRQFWIFDVQNPEEVRVNSSKIKVKQRGPYTYRVRYLAKENITQDPETHTVSFSQPNSA
IFEPSLSVGTENDTFTILNLAVAAAAHLYPSTLIQGLLNSYIKKSKSSMFQRRTVKELLW
GYTDPFLKLVPYPIATTVGVFYPYNNTADGVYKVFTGKDNISKVAIIDTYKGKKNLSYWP
SYCDMVNGTDAASFPPFVEKTRVLQFFSADICRSIYAVFGAEINLKGIPVYRFIVPSMAF
ASPLQNPDNHCFCTENVISKNCTLYGVLDISKCKEGKPVYISLPHFLHGSPELAIPIEGL
NSNEEEHRTYLDVEPITGFTLRFAKRLQVNMLVKPSKKIEALNGLKHNYIVPILWLNETG
TIGDEKAEMFRNQVTGKINLLGLVEMILLCVGVVMFVAFMISYCACRSKGVN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgaccgaaactgtgggctcatcgctggcgctgtcatcggtgcggtcctggct
gtgctgggaggtattctaatgccagttggagacatgctcattgagaagacaattaaaaag
gaagttgtcctggaagaaggtacaattgcttttaaaaactgggttaaaacaggaacagaa
gtttacagacagttctggatctttgatgtgcagaatccagaggaagtgagagttaacagc
agcaaaattaaagttaagcaaagaggtccttacacatacagagttcgttatctagccaag
gaaaatataacccaggaccctgagacccacacggtctctttcagtcagcccaacagtgcc
atctttgaaccctcactatcagttggaacagagaatgacactttcaccattctcaatctg
gctgtagcagctgcagcccacctctatccaagtacacttattcaaggattgctcaattca
tatatcaagaagtccaaatcttctatgtttcaaagaagaactgtgaaagaactattgtgg
ggctatacagatccattcttgaaattggttccataccctattgctaccacagttggtgtg
ttttatccttacaataatactgcagatggagtttataaagttttcaccggaaaagacaac
ataagcaaagttgccataattgacacatataaaggcaaaaagaatctctcctattggcca
agttattgtgacatggttaatggtacagatgcagcctcctttccacctttcgttgagaag
acccgggtattgcagttcttttccgctgacatttgcaggtcaatctatgctgtgtttgga
gccgaaattaatctgaaaggaatccctgtgtatagatttattgttccatccatggctttt
gcatctccacttcaaaacccagacaaccattgtttctgcacagaaaacgttatctcaaaa
aattgtacattatatggtgtgctagatattagcaaatgtaaagaaggaaaacctgtgtac
atttcacttcctcattttctacatggaagtcctgaacttgcaatacctattgaaggcttg
aattcaaatgaagaagaacacaggacctatttagatgttgaacctataactggattcact
ctacgatttgcaaaacgactgcaggtcaacatgttggtcaaaccatcaaaaaaaattgaa
gcattaaacggtctgaagcataactatatcgtgcctattctttggcttaatgagactggc
accattggtgatgagaaggcagaaatgttcagaaatcaagtgactggaaaaataaacctc
cttggcctggtagaaatgatcttactatgtgttggtgtggtgatgtttgttgcttttatg
atttcatactgtgcgtgcagatcaaagggagtaaactaa

DBGET integrated database retrieval system