KEGG   Camelus dromedarius (Arabian camel): 105100510Help
Entry
105100510         CDS       T04642                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00010  Glycolysis / Gluconeogenesis
cdk00030  Pentose phosphate pathway
cdk00051  Fructose and mannose metabolism
cdk00052  Galactose metabolism
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk01230  Biosynthesis of amino acids
cdk03018  RNA degradation
cdk04152  AMPK signaling pathway
cdk05230  Central carbon metabolism in cancer
Module
cdk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105100510 (PFKP)
   00030 Pentose phosphate pathway
    105100510 (PFKP)
   00051 Fructose and mannose metabolism
    105100510 (PFKP)
   00052 Galactose metabolism
    105100510 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105100510 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105100510 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    105100510 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105100510 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105100510 (PFKP)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105100510 (PFKP)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105100510 (PFKP)
Messenger RNA biogenesis [BR:cdk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105100510 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105100510
NCBI-ProteinID: XP_010991822
LinkDB All DBs
Position
Un
AA seq 752 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARC
KDFRSREGRLKAAYNLIQLGITNLCVIGGDGSLTGANIFRSEWGSLLEELLKEGKIDKEE
VQKHSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQESMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPACVVSLRGTRAVRLPLMECVQMTQDVQKAMDERRFKDAVKLRGRNFESNLNTYKRLA
IKLPDSQIPKSNCNVAVVNVGAPAAGMNAAVRAAVRVGIADGHRMFAVYDGFEGFARGQI
KEIGWSGVGGWTGQGGSILGTKRTLPGKFLQDIAAQMRAHGINALLVIGGFEAYLGLLEL
SAARERHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRN
ESCSVNYTTDFIYQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKLSARAMQWVT
AKLKEPQGAGKRFVADDSVCVLGISKRNLVFQPVAELKKDTDFEHRIPKEQWWLKLRPLM
KILAKYKASLELSDTGQLEHLQHRGPEELAAI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgccgtccgagctgtcgtgcgcatgggaatctacgtgggggccaaggtgtac
tttatctacgagggctaccagggcatggtggacggcggcagcaacatcgtcgaggcggac
tgggagagcgtctccagcatcctgcaagtgggagggaccattatcggcagcgcccggtgc
aaggactttcgttcccgggaaggccgcttgaaggctgcttataacttgatccagctgggc
atcaccaacctgtgtgtgatcggtggggacggcagtctcaccggcgccaacatcttccgc
agcgagtggggcagcctgctggaggagctgctgaaggaaggcaagatcgacaaggaggag
gtgcagaagcactcctacctcaacgtggtggggatggtgggctccatcgacaacgacttc
tgcggcacggacatgaccatcggcacggactcggccctgcacaggatcatcgaggtcgtg
gacgccatcatgacgactgcacagagccaccagcggaccttcgttctggaggtgatgggg
agacactgcgggtacctggccctggtgagcgccttggcctgcggggccgactgggtgttc
cttccggagtctccaccagaagaaggctggcaggagagcatgtgcgtcaagctgtcggag
aaccgcgcccggaaaaaaaggctgaacatcatcattgtggcagaaggagccatcgatacc
cagaataaacccatcacctctgagcaaatcaaggagctcgtggtcacgcagctgggttac
gacacgcgagtgaccatcctgggacatgtgcaaagaggcgggacgccgtcagcctttgac
aggattctggccagccgcatgggggtggaggccgtggtcgccctcctgcaggccacccct
gagaccccagcctgcgtggtgtcgctgagggggacccgggcggtgcggctgccgctgatg
gagtgtgtgcagatgacccaagatgtacaaaaggcgatggatgagaggagatttaaggac
gctgtgaaactccgaggaaggaacttcgagagcaacctgaacacttacaagaggctcgcc
atcaagctgcctgactcccagatcccaaagagcaactgcaacgtggccgttgtgaacgtg
ggcgcgcccgccgccggcatgaacgcggccgtgcgcgcggccgtgcgcgtgggcatcgcc
gacggacacaggatgttcgccgtgtacgacggcttcgagggcttcgccagaggccagata
aaagaaatcggctggtcaggtgtcggaggctggaccggccaaggaggctccatcctgggg
acaaaacgcacccttcccgggaagttcttgcaggacatcgcggcccagatgcgcgctcac
ggcatcaacgcgctcctggtcatcgggggctttgaggcctacctgggactgctggagctg
tctgccgcccgggagaggcacgaggagttctgtgtccccatggtcatggttcccgccacc
gtgtccaacaacgtcccggggtccgacttcagcatcggggccgacaccgccctcaacacc
atcaccgacacgtgcgaccgcatcaagcagtcggccagcgggacgaagcgccgcgtcttc
atcatagagaccatgggcggctactgcggctacctggccaacatggggggcctggccgcc
ggggccgatgccgcctacatcttcgaggagcccttcgacatccgggacctgcagtccaac
gtggagcacctgacggagaagatgaagaccaccatccagaggggcctcgtgctcaggaac
gagagctgcagcgtgaactacacgaccgacttcatctaccagctctactccgaggaaggc
cggggcgtattcgactgtaggaagaacgtgctgggccacatgcagcagggcggggcgcct
tcgccgtttgacagaaacttcgggaccaaactctctgccagagccatgcagtgggtcacc
gcgaagctgaaggagccgcagggggcaggaaaaaggtttgtagcggatgattccgtgtgt
gtgctgggaataagcaaaaggaaccttgtcttccagcctgtggcagagctgaagaaggac
acagacttcgagcacaggatccccaaggagcagtggtggctgaagctccggcccctcatg
aagatcctggccaagtacaaggccagcctcgagctgtcggacaccgggcagctggagcac
ctgcagcaccggggccccgaggagctggccgccatctag

DBGET integrated database retrieval system