KEGG   Camelus dromedarius (Arabian camel): 105100748
Entry
105100748         CDS       T04642                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04020  Calcium signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04260  Cardiac muscle contraction
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04270  Vascular smooth muscle contraction
cdk04713  Circadian entrainment
cdk04720  Long-term potentiation
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04727  GABAergic synapse
cdk04728  Dopaminergic synapse
cdk04742  Taste transduction
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04924  Renin secretion
cdk04925  Aldosterone synthesis and secretion
cdk04927  Cortisol synthesis and secretion
cdk04929  GnRH secretion
cdk04930  Type II diabetes mellitus
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05031  Amphetamine addiction
cdk05410  Hypertrophic cardiomyopathy
cdk05412  Arrhythmogenic right ventricular cardiomyopathy
cdk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105100748 (CACNA1C)
   04020 Calcium signaling pathway
    105100748 (CACNA1C)
   04024 cAMP signaling pathway
    105100748 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    105100748 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105100748 (CACNA1C)
   04929 GnRH secretion
    105100748 (CACNA1C)
   04912 GnRH signaling pathway
    105100748 (CACNA1C)
   04921 Oxytocin signaling pathway
    105100748 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    105100748 (CACNA1C)
   04924 Renin secretion
    105100748 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    105100748 (CACNA1C)
   04927 Cortisol synthesis and secretion
    105100748 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105100748 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    105100748 (CACNA1C)
   04270 Vascular smooth muscle contraction
    105100748 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    105100748 (CACNA1C)
   04727 GABAergic synapse
    105100748 (CACNA1C)
   04725 Cholinergic synapse
    105100748 (CACNA1C)
   04728 Dopaminergic synapse
    105100748 (CACNA1C)
   04726 Serotonergic synapse
    105100748 (CACNA1C)
   04720 Long-term potentiation
    105100748 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    105100748 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    105100748 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105100748 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105100748 (CACNA1C)
   05020 Prion disease
    105100748 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    105100748 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    105100748 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    105100748 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105100748 (CACNA1C)
   05414 Dilated cardiomyopathy
    105100748 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105100748 (CACNA1C)
   04934 Cushing syndrome
    105100748 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cdk04040]
    105100748 (CACNA1C)
Ion channels [BR:cdk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105100748 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 105100748
NCBI-ProteinID: XP_031300270
LinkDB
Position
34
AA seq 2163 aa
MVNENTRMYIPEENHQGPSYGSPRPAHTNMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIVFTVEALLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYS
EEGAADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIEPENEDEGLDEERPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMHDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEMVEKPAVEETKEEKIELKSITAAGESPPATKINMDDLQPNESEDKASYPRP
EATGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSANNRFRLQCHRIVNDS
IFTNLILFFILLSSVSLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECRGNYITYKDGE
VDHPIVQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNVLNMLFTG
LFTVEMLLKLIAFKPKGYFSDPWNVFDFLIVIGSVIDVILSETNHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPCQRSALSLQ
AGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYPS
DGRSAFPQTFTTQRPLHISKAGSSQADPESPSHEKLVDSTFTPSSYSSTGSNANINNANN
TALGRCPRPAGDPGAVSTLEGCGTPLSPAVRLQEAAWRHSSKRCPSRESPIAMVCPEEAS
RGEARDMQTLEDAEFGSEPSLIPTEMLSYQDDESRQLTPPEEDRRDVRLSPKRGFLRSAS
LGRRASFHLECLKRQRNHWGDVSQKTVLPLHLVHQQALAVAGLSPLLQRSHPPSTLPLPC
TTPPATPGARGRPPQPVPTLQLEGAEAVEKLDSSFPSIHCSHRPGEPTPDAPRRARPVSL
MVPSPAVARGRQLHGSASSLVEAVLISEGLGKFAQDPKFLEATTQELADACDMTIEEMES
AADNILSGGAGQSPNGTLLPFANCRDPGPDRAGGTEDAAWAPSPEPPESEEELLDHGALV
SSL
NT seq 6492 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacatcccagaggaaaaccaccaaggtcccagctat
gggagcccgcgcccggctcataccaacatgaacgccaacgcggccgcggggctggccccc
gagcacatccccacgccgggggccgcgctgtcctggcaggcggccatcgacgcggcccgg
caggccaagctgatgggcagcgccggcaacgccaccatctccacggtcagctccacgcag
cgcaagcggcagcagtacggcaaacccaagaagcagggcagcaccacggccacccgcccg
ccccgcgcgctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtggagtggaagccatttgaaatcattattttactgacgatttttgccaattgcgtggcc
ttagccatctacatccccttcccagaagacgactccaacgccaccaattccaacctggag
cgagtggagtacctcttcctcatcgttttcactgtggaggcgctgttaaaagtcattgcc
tacggactcctcttccacccgaacgcttacctgcgcaacggctggaatctcctcgacttc
atcattgtggttgtcgggctcttctctgccatcttagagcaagccaccaaagcggacggg
gcgaacgcactcggagggaagggggctggattcgacgtgaaggcgctgagggcgttccgc
gtgctgcggcccctgcggctggtgtccggcgtcccaagcctgcaggtggtcctgaactcc
atcatcaaagccatggtgcccctgctgcacatcgcgctgctggtgctgttcgtcatcatc
atctacgccatcatcggcctggagctcttcatgggaaagatgcacaagacctgctacagc
gaggagggcgccgcagatgtcccggcagaagacgacccctccccctgcgccctggagacg
ggccacgggcgccagtgccagaacggcacggtgtgcaagccagggtgggacgggcccaag
cacggcatcaccaactttgacaacttcgccttcgccatgctcaccgtgttccagtgcatc
accatggagggctggaccgacgtgctgtactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgtccttagcggagagttttccaaagagagggagaaggccaaggcccggggcgac
ttccagaagctgcgggagaagcagcagctggaggaggacctgaagggctacctggactgg
atcacgcaggcggaggacatagagcccgagaacgaggacgagggcctggacgaggagaga
ccccgcaacatgagcatgcccaccagtgagaccgagtcggtcaacaccgaaaacgtggct
ggaggcgacatcgagggagaaaactgcggggcccgactggcccaccggatctccaagtcc
aagttcagccgctactggcgccgatggaaccggttctgcaggaggaagtgccgtgcggcc
gtgaagtcgagcatcttctactggctggtcatcttcctggtgttcctcaacacgctcacc
atcgcctccgagcactacaaccagccccactggctcacggaggtccaagacacagccaac
aaggccctgctggccctcttcacggccgagatgctgctcaagatgtacagcctggggctg
caggcctacttcgtgtcgctcttcaaccgcttcgactgcttcatcgtgtgcggtggcatc
ctggagaccatcctggtggagaccaaggtcatgtccccgctgggcatctccgtgctgaga
tgcgtccgcctcctgcgcatatttaagatcacgaggtactggaactccctgagcaacctg
gtggcctccctgctcaactccgtgcgctccatcgcctccctgctgctgctgctcttcctc
ttcatcatcatcttctccctcctggggatgcagctcttcggagggaagttcaacttcgac
gagatgcagacccgcaggagcacgttcgacaactttccgcagtccctgctcaccgtgttt
cagatcctgaccggggaggactggaactcggtgatgcatgatggcatcatggcttatggc
ggcccctcttttccagggatgctagtctgtatttacttcatcatcctcttcatctgtggg
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggcagatgctgag
agcctcacctctgcccagaaggaggaggaagaagagaaggagagaaagaagctggccagg
actgccagcccagagaagaaacaagagatggtggagaagccagcagtggaggagaccaag
gaggaaaaaattgagctgaaatccatcacagccgccggagagtccccgccggccaccaag
atcaacatggatgacctccagcccaacgaaagtgaggacaaggcttcctacccccgcccg
gaagcaacaggagaggaggacgaggaggagccggagatgccggtgggcccgcgcccgcgc
cctctctctgagctgcacctgaaggagaaggccgtgcccatgccagaagccagcgctttc
ttcatcttcagcgccaacaacaggttccgccttcagtgccaccgcatcgtcaacgactcc
atcttcaccaacctgatcctcttcttcatcctgctcagcagcgtctccctggccgccgag
gacccggtccagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatgaccgcctacggggccttcctgcac
aagggctccttctgccggaactacttcaacatccttgacctgctggtggtcagcgtgtcc
ctcatctccttcggcatccagtccagcgccatcaatgtggtgaagatcctgcgggtcctc
agggtgctcaggcccctccgggccatcaacagggccaaggggctgaagcacgtggtgcag
tgcgtgttcgtggccatccgcaccatcgggaacatcgtgatcgtcaccacgctgctccag
ttcatgttcgcctgcatcggggtccagctcttcaagggcaagctctacacctgttccgac
agctccaagcagacggaggcggagtgcagggggaactacatcacgtacaaggacggggag
gttgaccaccccatcgtccagccccgcagctgggagaacagcaagtttgacttcgacaac
gttctggccgccatgatggccctgttcaccgtctccacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacggaggacaagggccccatctacaactaccgcgtg
gagatctccgtcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacata
ttcgtgggcttcgtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgc
gagctggacaagaaccagcggcagtgcgtggagtacgccctgaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
tttgagtacctgatgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcac
tacgggcagagctgcctgttcaaaatcgccatgaacgtcctgaacatgctcttcaccggc
ctcttcacagtggagatgcttctcaagctcatcgccttcaagcccaagggttactttagt
gacccctggaatgtctttgacttcctcatcgtaattggcagcgtaattgacgtcattctc
agtgagacgaatcactatttctgtgatgcatggaacacgtttgacgccttgattgttgtg
ggtagcattgttgatatagcgatcaccgaggtaaacccagctgaacatacccaatgttct
ccctttatgaacgcggaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgcctggtcaaactgctgagccgcggggagggcatccggaccctgctgtggacc
ttcatcaagtcctttcaggccctgccctacgtggccctcctgatcgtgatgctcttcttc
atctacgccgtcatcgggatgcaggtgtttgggaaaatcgccctgaacgacacgacggag
atcaaccggaacaacaacttccagaccttcccccaggccgtgctgctgctcttcaggtgc
gccacgggtgaggcctggcaggacatcatgctggcctgcatgcctgggaagaagtgcgcc
cccgagtcggagccaggcaacagcacggagggggagacgccctgcggcagcagcttcgcc
gtcttctacttcatcagcttctacatgctgtgtgccttcctgatcatcaacctctttgtg
gccgtcatcatggacaactttgactacctgacgcgggactggtccatcctgggtccccac
cacttggacgagtttaagagaatctgggcggagtacgaccctgaagccaagggccgcatc
aaacacctggatgtggtgacgctgctgcggcgcatccagcccccgctgggtttcgggaag
ctgtgccctcaccgcgtggcctgcaaacgcctggtctccatgaacatgcctctcaacagc
gacgggacggtcatgttcaacgccacgctgttcgccctggtccggacagccctgaggatc
aaaacggaagggaacctggagcaggccaacgaggagctgcgggccatcatcaagaagatc
tggaagcggacgagcatgaagctgctggaccaggtggtgccgcccgcaggagacgacgag
gtcacggtcggcaagttttacgccaccttcctgatccaggagtacttccggaagttcaag
aagcgcaaagagcagggcctcgtgggcaagccctgccagaggagcgccctgtccctgcag
gctggcctgcgcaccctgcatgacctggggcccgagatccgcagggccatctccggggac
ctgacggccgaggaggagctggacaaagccatgaaggaggcggtgtccgcagcctcggag
gacgacatcttcaggagggccggaggcctgttcggcaaccacgtcggctactaccccagc
gacggccggagcgccttcccgcagaccttcaccacgcagcggcccctgcacatcagcaag
gcgggcagcagccaggccgaccccgagtcgccctcccacgagaagctagtggactccacc
ttcacacccagcagctactcatccacgggctccaacgccaacatcaacaatgccaacaac
acggccctgggccgctgcccccgccctgccggcgacccgggggctgtcagcacgctggag
ggctgcgggacccccttgtcccccgccgtccggctgcaggaggccgcgtggaggcacagc
tccaagaggtgcccctcccgggagagtcctatagccatggtgtgcccagaggaggcctct
cggggcgaggcccgtgacatgcagacgcttgaggacgcggagttcggcagcgagcccagc
ctgatccccaccgagatgctctcctatcaggatgacgagagccgacagctgacacccccc
gaggaggacaggagggacgtccggctatctccaaagagaggcttcctgcgctccgcctcc
ctaggtcgaagggcctccttccacctggagtgtctgaagcggcagaggaatcactgggga
gacgtctctcagaagacggtcctgcccttgcacctggttcaccagcaggcattggcagtg
gcgggcctgagccccctcctccagagaagccatccccccagcaccctccccctgccgtgc
acaacaccccctgccacgccgggcgcccgcggccggcccccgcagcccgtgcccaccctg
cagctggagggggccgaggccgtggagaagctcgacagcagcttcccgtccatccactgc
agccaccggccgggggagcccacgccggatgccccccggagagcccggcctgtgtccctg
atggtgcccagcccagcggtggcccggggccgccagctccacggcagcgccagcagcttg
gtggaagcggtcttgatctcggaaggactgggaaagtttgctcaggaccccaagttcctg
gaggccaccacgcaagagctggcagacgcctgcgacatgacgatagaggagatggagagt
gcggccgacaacattctcagcgggggcgccgggcaaagccccaacggcaccctgcttcct
tttgcaaactgcagggacccggggccggacagagcggggggcacggaggatgcggcctgg
gcgcccagccccgagccccctgagagcgaggaggagctcctggaccatggggccttggtc
agcagcctgtag

DBGET integrated database retrieval system