KEGG   Camelus dromedarius (Arabian camel): 105100776Help
Entry
105100776         CDS       T04642                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04020  Calcium signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04114  Oocyte meiosis
cdk04140  Autophagy - animal
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04270  Vascular smooth muscle contraction
cdk04310  Wnt signaling pathway
cdk04340  Hedgehog signaling pathway
cdk04371  Apelin signaling pathway
cdk04530  Tight junction
cdk04540  Gap junction
cdk04611  Platelet activation
cdk04713  Circadian entrainment
cdk04714  Thermogenesis
cdk04720  Long-term potentiation
cdk04723  Retrograde endocannabinoid signaling
cdk04724  Glutamatergic synapse
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04727  GABAergic synapse
cdk04728  Dopaminergic synapse
cdk04740  Olfactory transduction
cdk04742  Taste transduction
cdk04750  Inflammatory mediator regulation of TRP channels
cdk04910  Insulin signaling pathway
cdk04911  Insulin secretion
cdk04912  GnRH signaling pathway
cdk04913  Ovarian steroidogenesis
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04922  Glucagon signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
cdk04924  Renin secretion
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04961  Endocrine and other factor-regulated calcium reabsorption
cdk04962  Vasopressin-regulated water reabsorption
cdk04970  Salivary secretion
cdk04971  Gastric acid secretion
cdk04976  Bile secretion
cdk05012  Parkinson disease
cdk05020  Prion diseases
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05032  Morphine addiction
cdk05034  Alcoholism
cdk05146  Amoebiasis
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105100776
   04010 MAPK signaling pathway
    105100776
   04310 Wnt signaling pathway
    105100776
   04340 Hedgehog signaling pathway
    105100776
   04371 Apelin signaling pathway
    105100776
   04020 Calcium signaling pathway
    105100776
   04024 cAMP signaling pathway
    105100776
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105100776
  09143 Cell growth and death
   04114 Oocyte meiosis
    105100776
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105100776
   04540 Gap junction
    105100776
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105100776
   04062 Chemokine signaling pathway
    105100776
  09152 Endocrine system
   04911 Insulin secretion
    105100776
   04910 Insulin signaling pathway
    105100776
   04922 Glucagon signaling pathway
    105100776
   04923 Regulation of lipolysis in adipocytes
    105100776
   04912 GnRH signaling pathway
    105100776
   04913 Ovarian steroidogenesis
    105100776
   04915 Estrogen signaling pathway
    105100776
   04914 Progesterone-mediated oocyte maturation
    105100776
   04921 Oxytocin signaling pathway
    105100776
   04926 Relaxin signaling pathway
    105100776
   04935 Growth hormone synthesis, secretion and action
    105100776
   04918 Thyroid hormone synthesis
    105100776
   04919 Thyroid hormone signaling pathway
    105100776
   04928 Parathyroid hormone synthesis, secretion and action
    105100776
   04916 Melanogenesis
    105100776
   04924 Renin secretion
    105100776
   04925 Aldosterone synthesis and secretion
    105100776
   04927 Cortisol synthesis and secretion
    105100776
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105100776
   04270 Vascular smooth muscle contraction
    105100776
  09154 Digestive system
   04970 Salivary secretion
    105100776
   04971 Gastric acid secretion
    105100776
   04976 Bile secretion
    105100776
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105100776
   04961 Endocrine and other factor-regulated calcium reabsorption
    105100776
  09156 Nervous system
   04724 Glutamatergic synapse
    105100776
   04727 GABAergic synapse
    105100776
   04725 Cholinergic synapse
    105100776
   04728 Dopaminergic synapse
    105100776
   04726 Serotonergic synapse
    105100776
   04720 Long-term potentiation
    105100776
   04723 Retrograde endocannabinoid signaling
    105100776
  09157 Sensory system
   04740 Olfactory transduction
    105100776
   04742 Taste transduction
    105100776
   04750 Inflammatory mediator regulation of TRP channels
    105100776
  09149 Aging
   04211 Longevity regulating pathway
    105100776
   04213 Longevity regulating pathway - multiple species
    105100776
  09159 Environmental adaptation
   04713 Circadian entrainment
    105100776
   04714 Thermogenesis
    105100776
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105100776
   05205 Proteoglycans in cancer
    105100776
   05203 Viral carcinogenesis
    105100776
  09164 Neurodegenerative disease
   05012 Parkinson disease
    105100776
   05020 Prion diseases
    105100776
  09165 Substance dependence
   05030 Cocaine addiction
    105100776
   05031 Amphetamine addiction
    105100776
   05032 Morphine addiction
    105100776
   05034 Alcoholism
    105100776
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    105100776
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105100776
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105100776
   05163 Human cytomegalovirus infection
    105100776
   05165 Human papillomavirus infection
    105100776
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105100776
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105100776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105100776
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cdk03019]
    105100776
   03036 Chromosome and associated proteins [BR:cdk03036]
    105100776
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105100776
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: AGC group
  PKA family
   105100776
Messenger RNA biogenesis [BR:cdk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105100776
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105100776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 105100776
NCBI-ProteinID: XP_031293304
LinkDB All DBs
Position
22
AA seq 293 aa AA seqDB search
MLVKHKESGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLY
MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWF
ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctagtaaagcacaaggagagcggaaaccactttgccatgaagatccttgacaaacag
aaggtggtgaagctgaaacagattgagcataccctgaacgaaaagcgcatcctgcaggcg
gtcaactttccgttccttgtcaaactcgagttctccttcaaggacaattcaaatttatac
atggtcatggagtacgtgcccggtggggagatgttctcacacctgcggcggatcgggaga
ttcagtgagccccatgcccgcttctatgcggcccagatcgtcctgaccttcgagtacctg
cactcgctcgatctcatctaccgggacctgaagccagagaacctcctcatcgaccagcag
ggctacattcaggtgacggacttcggtttcgccaagcgtgtgaaaggccgcacctggacc
ttgtgtgggacccccgagtacctggcccctgagatcatcctgagtaaaggctacaacaaa
gctgtggactggtgggccctgggggttctcatctatgagatggctgcaggctacccgccc
ttcttcgcggaccagcccatccagatctacgagaagattgtctctgggaaggtgcggttc
ccatcccatttcagctctgacctgaaggatctgctgcggaatcttctgcaggttgacctc
accaaacgctttgggaacctcaagaatggggtcaatgacatcaagaaccacaagtggttt
gccacgactgactggattgctatctaccagaggaaggtggaagctcccttcataccaaag
tttaaaggccctggggacacaagtaactttgacgactatgaggaggaagagatccgagtc
tccatcaatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system