KEGG   Camelus dromedarius (Arabian camel): 105101086
Entry
105101086         CDS       T04642                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04115  p53 signaling pathway
cdk04120  Ubiquitin mediated proteolysis
cdk04144  Endocytosis
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04625  C-type lectin receptor signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105101086 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105101086 (MDM2)
   04151 PI3K-Akt signaling pathway
    105101086 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105101086 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    105101086 (MDM2)
   04115 p53 signaling pathway
    105101086 (MDM2)
   04218 Cellular senescence
    105101086 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105101086 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105101086 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101086 (MDM2)
   05202 Transcriptional misregulation in cancer
    105101086 (MDM2)
   05206 MicroRNAs in cancer
    105101086 (MDM2)
   05205 Proteoglycans in cancer
    105101086 (MDM2)
   05203 Viral carcinogenesis
    105101086 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    105101086 (MDM2)
   05220 Chronic myeloid leukemia
    105101086 (MDM2)
   05218 Melanoma
    105101086 (MDM2)
   05219 Bladder cancer
    105101086 (MDM2)
   05215 Prostate cancer
    105101086 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    105101086 (MDM2)
   05169 Epstein-Barr virus infection
    105101086 (MDM2)
   05165 Human papillomavirus infection
    105101086 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105101086 (MDM2)
   01522 Endocrine resistance
    105101086 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105101086 (MDM2)
   04121 Ubiquitin system [BR:cdk04121]
    105101086 (MDM2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105101086 (MDM2)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    105101086 (MDM2)
Ubiquitin system [BR:cdk04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    105101086 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 105101086
NCBI-ProteinID: XP_010992491
UniProt: A0A5N4DGT2
LinkDB
Position
12
AA seq 491 aa
MCNTNMSVSTEGAVSTSQIPPSEQETLVRPKPLLLKLLRSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSGT
PVSERRCHPEGGSDQKDLVQELQEEKPSSSDLVSRPSTSSRRRTVSETEENADELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWFDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKEKMPEKAKQENSTQVEKGFDVP
DCKKSTVNDSRESCVEENEDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgagggtgctgtaagcacctcacagattcca
ccttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttaaggtct
gttggtgcacagaaggacacttatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgaaaaacaacagcatattgtgtattgttcaaatgac
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcaggaaccatcggattcaggcaca
cctgtgagtgaaagaaggtgtcaccccgaaggtggtagtgatcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttccagaccatctacctcatct
agaaggcgaacagttagtgagacagaagaaaatgcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataacatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgctgcgaaagaagcagtagcagtgaatctacagggactccatcg
aatccggatcttgatgctggtgtaagtgaacattcaggtgactggttcgatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtcccttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtgtatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcctgcagtgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagagaaa
atgcctgagaaagccaaacaagaaaactcaacacaagtagaaaagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccagagaatcatgtgttgaggaaaatgaagat
aagatcacacaagcctccctgtcccaagaaagtgaggactattctcagccgtcaacttct
aatagcattatctatagtagccaagaagatgtcaaggagtttgagagggaagaaacacaa
gacaaagaagaaagtgtggaatctagttttccccttaatgccattgaaccatgtgtgatt
tgccaaggtcgacctaaaaatggttgcatcgtccatggcaagacaggacatcttatggct
tgctttacatgcgcaaagaagctaaagaaaaggaataagccctgcccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system