KEGG   Camelus dromedarius (Arabian camel): 105101330
Entry
105101330         CDS       T04642                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04630  JAK-STAT signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105101330 (CDKN1A)
   04630 JAK-STAT signaling pathway
    105101330 (CDKN1A)
   04066 HIF-1 signaling pathway
    105101330 (CDKN1A)
   04068 FoxO signaling pathway
    105101330 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    105101330 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105101330 (CDKN1A)
   04115 p53 signaling pathway
    105101330 (CDKN1A)
   04218 Cellular senescence
    105101330 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    105101330 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    105101330 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101330 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    105101330 (CDKN1A)
   05206 MicroRNAs in cancer
    105101330 (CDKN1A)
   05205 Proteoglycans in cancer
    105101330 (CDKN1A)
   05203 Viral carcinogenesis
    105101330 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105101330 (CDKN1A)
   05212 Pancreatic cancer
    105101330 (CDKN1A)
   05225 Hepatocellular carcinoma
    105101330 (CDKN1A)
   05226 Gastric cancer
    105101330 (CDKN1A)
   05214 Glioma
    105101330 (CDKN1A)
   05216 Thyroid cancer
    105101330 (CDKN1A)
   05220 Chronic myeloid leukemia
    105101330 (CDKN1A)
   05217 Basal cell carcinoma
    105101330 (CDKN1A)
   05218 Melanoma
    105101330 (CDKN1A)
   05211 Renal cell carcinoma
    105101330 (CDKN1A)
   05219 Bladder cancer
    105101330 (CDKN1A)
   05215 Prostate cancer
    105101330 (CDKN1A)
   05213 Endometrial cancer
    105101330 (CDKN1A)
   05224 Breast cancer
    105101330 (CDKN1A)
   05222 Small cell lung cancer
    105101330 (CDKN1A)
   05223 Non-small cell lung cancer
    105101330 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105101330 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105101330 (CDKN1A)
   05161 Hepatitis B
    105101330 (CDKN1A)
   05160 Hepatitis C
    105101330 (CDKN1A)
   05163 Human cytomegalovirus infection
    105101330 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105101330 (CDKN1A)
   05169 Epstein-Barr virus infection
    105101330 (CDKN1A)
   05165 Human papillomavirus infection
    105101330 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105101330 (CDKN1A)
   01522 Endocrine resistance
    105101330 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105101330
NCBI-ProteinID: XP_010992776
UniProt: A0A5N4CSH8
LinkDB
Position
20
AA seq 164 aa
MSEPSRDAHQIPRSSKACRRLFGPVDSEQLSRDCDALMASCVQEARDRWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPAGPRGAWDDLGGGKRPSTSPALLQGTSQEDHVDLSLSCTLV
PRSPERPEESPGGPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatccagggatgcccatcagatcccacgcagcagcaaggcgtgccgtcgc
ctcttcggcccagtggacagtgagcaactgagccgggactgtgacgcactgatggccagc
tgtgtgcaggaggcccgggatcgatggaacttcgactttgtcaccgagacaccgctggag
ggtgactttgcctgggagcgtgtgcggggccttggcctgcccaagctctacctgcctgca
gggccccggggggcctgggatgacctgggagggggcaagcggcccagcacctcgcctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcactgtcttgcacccttgtg
cctcgctcccctgagcggcctgaggagtccccaggtgggcctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system