KEGG   Camelus dromedarius (Arabian camel): 105101350Help
Entry
105101350         CDS       T04642                                 

Gene name
PPARD
Definition
(RefSeq) peroxisome proliferator-activated receptor delta isoform X1
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04310  Wnt signaling pathway
cdk05200  Pathways in cancer
cdk05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105101350 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105101350 (PPARD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101350 (PPARD)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    105101350 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105101350 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105101350 (PPARD)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    105101350 (PPARD)
Nuclear receptors [BR:cdk03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   105101350 (PPARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 105101350
NCBI-ProteinID: XP_010992799
LinkDB All DBs
Position
20
AA seq 441 aa AA seqDB search
MEQPPEEAPEVREEEEKKEVAEAEGAPELNGGPEHSLPSSSCTDLSRSCSPPSLLDQLQM
GCDEASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQHNSQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccaccggaggaagcccctgaggtccgggaagaggaggagaaaaaggaagtg
gcagaggcagaaggagccccagagctcaatgggggaccagagcactcactcccttccagc
agctgcacagacctctcccggagctgctcccccccctcactgctggaccagctgcagatg
ggctgtgacgaggcctcgtgtggcagcctcaacatggagtgccgcgtgtgcggggacaag
gcatcaggcttccactacggtgtgcacgcatgcgaggggtgcaagggcttcttccgtcgg
acgatccgcatgaagctggaatacgagaagtgtgagcggatctgcaagatccagaagaag
aaccgcaacaagtgccagtactgccgcttccagaaatgcctggcgctgggcatgtcacac
aacgccatccgctttggccggatgccagaggctgagaagaggaagctggtggcagggctg
acggcgaatgaggggagtcagcacaactcccaggtggctgacctgaaggccttctccaag
cacatctacaatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcggcatc
ctcaccggcaaggccagccacacggcgccctttgtgatccacgacatcgagacattgtgg
caggcggagaagggcctggtatggaagcagctggtgaatggtctgcccccctacaaggag
atcagcgtgcatgtcttctaccgctgccagtgtaccacggtggagaccgtgcgtgagctc
acagagttcgccaagagcatccccagcttcagcaacctcttcctcaacgaccaggtgacc
ctgctcaagtatggtgtgcatgaggccatcttcgccatgctggcctctattgtcaataag
gacgggctgctggtggccaacggcactggctttgtcacccgtgagttcctgcgcagcctc
cgaaagcccttcagtgacatcatcgagcccaagttcgaatttgctgtcaagttcaatgcc
ctggaacttgatgacagtgacctggctctcttcatcgcggccatcattctgtgtggagac
cggccaggcctcatgaacgtgtcacaggtggaggccatccaggacaccatcctgcgtgcc
ctcgagttccacctgcaggccaaccaccccgacgcacagtacctcttccccaagctgctg
cagaagatggctgacctgcggcagctggtcaccgagcatgctcagatgatgcagcggatc
aagaagaccgagacagagacctcgctgcaccccctgctccaggagatctacaaggacatg
tactga

DBGET integrated database retrieval system