KEGG   Camelus dromedarius (Arabian camel): 105101376
Entry
105101376         CDS       T04642                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01524  Platinum drug resistance
cdk04141  Protein processing in endoplasmic reticulum
cdk04210  Apoptosis
cdk04215  Apoptosis - multiple species
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05132  Salmonella infection
cdk05160  Hepatitis C
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105101376 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105101376 (BAK1)
   04215 Apoptosis - multiple species
    105101376 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101376 (BAK1)
   05202 Transcriptional misregulation in cancer
    105101376 (BAK1)
   05206 MicroRNAs in cancer
    105101376 (BAK1)
   05203 Viral carcinogenesis
    105101376 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105101376 (BAK1)
   05212 Pancreatic cancer
    105101376 (BAK1)
   05225 Hepatocellular carcinoma
    105101376 (BAK1)
   05226 Gastric cancer
    105101376 (BAK1)
   05214 Glioma
    105101376 (BAK1)
   05216 Thyroid cancer
    105101376 (BAK1)
   05220 Chronic myeloid leukemia
    105101376 (BAK1)
   05217 Basal cell carcinoma
    105101376 (BAK1)
   05218 Melanoma
    105101376 (BAK1)
   05213 Endometrial cancer
    105101376 (BAK1)
   05224 Breast cancer
    105101376 (BAK1)
   05222 Small cell lung cancer
    105101376 (BAK1)
   05223 Non-small cell lung cancer
    105101376 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    105101376 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105101376 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105101376 (BAK1)
   05160 Hepatitis C
    105101376 (BAK1)
   05164 Influenza A
    105101376 (BAK1)
   05162 Measles
    105101376 (BAK1)
   05168 Herpes simplex virus 1 infection
    105101376 (BAK1)
   05163 Human cytomegalovirus infection
    105101376 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105101376 (BAK1)
   05169 Epstein-Barr virus infection
    105101376 (BAK1)
   05165 Human papillomavirus infection
    105101376 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105101376 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105101376 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105101376 (BAK1)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    105101376 (BAK1)
Transporters [BR:cdk02000]
 Other transporters
  Pores ion channels [TC:1]
   105101376 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 105101376
NCBI-ProteinID: XP_010992839
UniProt: A0A5N4CS61
LinkDB
Position
20
AA seq 211 aa
MASGQGPGPPRQGCGEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTNPEM
DTLPLEPTSTMGQVGRQLAIIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccggacaaggtccaggtcctcccaggcaggggtgtggagaacctgatccctcc
tccacttcggaggagcaggtagcccgggacacggaggaggttttccgcagctacgttttt
taccgccatcagcaggagcaggaggctgagggggcagctgcgcccaccaacccagagatg
gacaccttgcccctggaacctaccagcaccatggggcaggtgggtcgccagctcgccatc
atcggggacgacatcaaccggcgctacgactcagagttccaggccatgttgcagcacctg
cagccaacagcagagaatgcctacgagtatttcaccaagattgcctcgagcctgtttgag
agcggcatcaactggggccgagtggtggctctcctgggcttcggctaccgcctggcccta
catgtctaccagcgcggcctgactggcttcctgggccaggtgacccggttcgtggccgac
ttcatgttgcatcactgcattgcccggtggatcgcgcagaggggtggctgggtggcggcc
ctggacttgggaaatggccccatccgcaacgtgctgatagttctggccgtggttttgttg
ggccagtttgtggtacgaaggttcttcaagtcatga

DBGET integrated database retrieval system