KEGG   Camelus dromedarius (Arabian camel): 105101392Help
Entry
105101392         CDS       T04642                                 

Gene name
HSD17B8
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8 isoform X2
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00061  Fatty acid biosynthesis
cdk00140  Steroid hormone biosynthesis
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
Module
cdk_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105101392 (HSD17B8)
   00140 Steroid hormone biosynthesis
    105101392 (HSD17B8)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     105101392 (HSD17B8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     105101392 (HSD17B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR RmlD_sub_bind Epimerase Peptidase_C41 Periviscerokin
Motif
Other DBs
NCBI-GeneID: 105101392
NCBI-ProteinID: XP_010992870
LinkDB All DBs
Position
20
AA seq 272 aa AA seqDB search
MASQLRLRSALALVTGAGGGIGRAVSVRLAAEGAAVAACDLDGAAARETVRLLGGPGSEE
GAPCGAHAAFQADVSETRAVRRLLEQVQACFSRPPSVVVSCAGITRDEFLLHMSEDDWDR
VIAVNLKGIFLVNQAAAQALVSSGCPGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQT
AAREFGRHGIRCNSVLPGFIKTPMIQKVPQKVLDKVTGMIPMGRVGDPEDVADVVAFLAS
GDSGYITGASVEVTGMRPSWGGRGQRSATQMI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcagctccggctccgctcggctttggccctggtcacaggtgcgggtggcggc
atcggccgagcagtcagtgtgcgcctggccgctgagggggccgccgtggccgcttgcgac
ctggacggggcagcggcacgagagacggtgcggctgctgggagggccggggagcgaggag
ggggcgccctgcggggcccacgctgccttccaggctgacgtgtccgagaccagggccgtc
aggcgcttgctggagcaagtgcaggcctgcttttctcgcccgccatctgtcgttgtgtcc
tgtgcgggcatcaccagggatgagtttctgctccacatgtcggaagatgactgggacaga
gtcatagctgtcaacctcaagggcatcttcctagtcaatcaggctgcagcccaagccctg
gtgtccagtggctgtcctggctccatcatcaacatcagtagcatcgtagggaaggtgggg
aatgtgggacagacaaactacgcagcatccaaggctggagtgattgggctgacccagact
gcagcccgggagttcggacgacatgggatccgctgtaactctgtcctcccagggttcatt
aaaacacccatgatacagaaagtgcctcagaaagtgctggataaggtaactggaatgatc
ccaatgggacgtgtgggggaccctgaggatgtggcagatgtggtcgcattcttggcatct
ggagacagtggatacatcacaggggcgtcagtagaagtcactggtatgaggccatcttgg
ggaggaagagggcagagaagtgcaacccagatgatatga

KEGG   Camelus dromedarius (Arabian camel): 105101613Help
Entry
105101613         CDS       T04642                                 

Gene name
CBR4
Definition
(RefSeq) carbonyl reductase family member 4
  KO
K11539  carbonyl reductase 4 / 3-oxoacyl-[acyl-carrier protein] reductase beta subunit [EC:1.1.1.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00061  Fatty acid biosynthesis
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
Module
cdk_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105101613 (CBR4)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     105101613 (CBR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase Glyco_transf_5 NmrA
Motif
Other DBs
NCBI-GeneID: 105101613
NCBI-ProteinID: XP_010993117
LinkDB All DBs
Position
31
AA seq 237 aa AA seqDB search
MDKVCAVFGGSRGIGRAVARLMAQRGYRLAIVARNLQGARAAAGDLGGDHLAFSCDVSKE
HDVQRTFEEIEKTLGHVNFLVNAAGINRDSLLVRTNTEDMLSQLHTNLLGSMLTCKAAVK
TMIKQQRGSIVNVGSVIGLKGNAGQSVYSATKGGLVGFSRALAKEVARKKIRVNVVAPGF
VHTDMTKDLKEEHLKKSIPLERFGEPEDVARAVVFLLESPYVTGHVLVVDGGLQLTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtgtgcgccgtgttcggaggctcccgaggcatcggcagggcggtggcccgc
ctgatggcccagagaggctaccgactggccatcgtcgcccggaacctgcagggggccaga
gccgcggccggggacctgggcggagatcatttggcatttagctgtgatgtctccaaagag
catgatgtccaacgtacatttgaagagatagagaaaactctaggtcacgttaatttcctg
gtcaatgcagctggaattaacagggatagcctcttagtaaggacaaacactgaagatatg
ctgtctcagctgcacaccaacctcttgggctccatgctgacctgtaaagctgccgtgaag
accatgattaaacagcagagagggtccatcgtgaatgtcggaagcgtcattggtttgaaa
ggcaacgctggccagtctgtgtacagcgccactaaaggagggttggttggattttcacgg
gctctcgctaaagaagtagccagaaagaagatcagagtgaatgtagttgctccagggttt
gtgcacacggatatgacgaaagacttgaaagaagaacacttaaagaaaagcatccctctc
gagaggtttggagaacctgaggacgtggcccgagcggtcgtgttccttctggagtctccg
tacgtcaccgggcacgtgctggtggtggacggggggctccagctcaccatgtag

KEGG   Camelus dromedarius (Arabian camel): 105102220Help
Entry
105102220         CDS       T04642                                 

Gene name
FASN
Definition
(RefSeq) LOW QUALITY PROTEIN: fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00061  Fatty acid biosynthesis
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk04152  AMPK signaling pathway
cdk04910  Insulin signaling pathway
Module
cdk_M00082  Fatty acid biosynthesis, initiation
cdk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105102220 (FASN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    105102220 (FASN)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105102220 (FASN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105102220 (FASN)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105102220 (FASN)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     105102220 (FASN)
Lipid biosynthesis proteins [BR:cdk01004]
 Fatty acid synthase
  Animal type
   105102220 (FASN)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105102220 (FASN)
  Exosomal proteins of breast milk
   105102220 (FASN)
  Exosomal proteins of colorectal cancer cells
   105102220 (FASN)
  Exosomal proteins of bladder cancer cells
   105102220 (FASN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase Ketoacyl-synt_C KAsynt_C_assoc KR PS-DH ADH_zinc_N ADH_zinc_N_2 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_11 Thiolase_N PP-binding adh_short ACP_syn_III AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 105102220
NCBI-ProteinID: XP_031325265
LinkDB All DBs
Position
16
AA seq 2563 aa AA seqDB search
MEEVVIAGMSGKLPESENLEEFWANLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPASLRGTNTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFNFRGPSVSLDTACSSSLLALQNAYQAIRSGEC
PAAIVGGINILLKPNTSLQFLKLGLLSPEGTCKSFDETGNGYCRSEAVVAMLLTKKSLAR
RVYATILNAGTNTDGYKEEGITFPSGEVQEQLIRSLYEPAGLAPESLEYMEAHGTGTKVG
DPQELNSIVRALCATRQDPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPKIPALQDRRLQVVDRPLPIRGGNVGINSFGFGGSNVHVILQPNSQPPPPPAPHTAL
PRLLQASGRTLEAVQALLEQGLRHRQNLAFVSMLNDIAAAPPAAMPFRGYAVLGGEGSPQ
DVQQVPAGQRPLWFICSGMGAQWRGMGLSLMRLDSFRDSILRSDETVKPLGLQVSGLLQS
PDEATFDDIVHAFVSLTAIQIALIDLLTSMGLRPDGIIGHSLGEVACGYADGCLSQEEAV
LCAYWRGQCIKEANIPPGAMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQATMSE
FVQQLKQEGVFAKEVRTGGLAFHSYFMDSIAPTLLQALKKVIREPRPRSARWLSTSIPEA
QWQGSLARTSSAEYNVNNMVSPVLFQEALRHVPENAVVLEIAPHALLQAILKRGLKSSCT
ILPLMKKDHKDNLEFFLSNMGRLHLTGIDVKPNGLFPPVEFPAPRGTPLISPHIKWDHSQ
TWDVPASKDFPSGSSCSSATVYNIDTSPESPDHYLVDHCIDGRVIFPATGYLCLVWKTLA
RALGQNMEQVPVVFEDVTLYQATILPKTGTVPLKVRLLEASHAFEVSNNGSLIVSGKVRQ
WEDPNPKLFDSRDSVDPADPVPMLRLSLGDVYKELRLCGYDYGPHFQGILEAGLEGNAGR
LLWRENWVTFLDTMLQIIILGLGSHSLRLPTRITAIHIDPTTHRQKLYTLQGEAQVASVV
VNKCVNSIVAGGVLMSRVHSSTAPRRQEQLPPVLEKFCFTPYVEDGCLAGNMALQEGLQL
CRGLAQALQSKVAQQGLKMVVPGLDGAQAPREAPQQGLPRLLATACQLQLNGNLQLELGQ
VLARERPLLCDDPLLCGLLDSPALKACVDTALENMASLTMKVVEVLAADGQLYSRIPALL
STQPLVKLDYTVTDRHPQALEAAQAQLQQHNMTQGQWDPMDLAPSSLGAADLLVCNCALA
TLGNPATALGNMAATLKEGGFLLLHTLLRGYPLGETVAFLTCPEPHPGQQGLLSQDQWEG
LFAGASLHLVALKRSFYGSVLFLCRRLAPQASPVFLPVEDTSFRWVDSLKNILADSSSQR
VWLMATGCTTSGVVGMAKCLRKEPGGHRIRCILVSNLSSTSPVPEVDPGSPELQKVLQRD
LVMNVYRDGAWGAFHHFPLEQDKPEEQTEHAFVDVLTRGDLSSIRWVCSPLRHAQPPGPG
VQLCTIYYASLNFRDIMLATGKLSPDAIPGKRAAQDCLLGMEFSGRDASGKRVMGLVSAK
GLATSVLVPQYSLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVQPGETVLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSAAKQAYLQARFPQLNETSFANSRDTSFEQHVLWHTAGKG
ECDLVLNSLAEEKLQASVRCLAQHGRFLEXGKFDLSNNNPLGMASFLKNVXFHGILLDAI
TEGNSPVWRGGVGPAAGGVQEGVVQPXKRTVFQDRWEDAFRYMAQGKHIGKVVIQVHEEE
PEAVVRGVRPTQQQALSRTFCLAHKSXIITGGLGGFGLELAQWLVGEGPRSWVLTSASGI
RTGYQARQIHAWRHQGVQVLVSTSNVSSRTVPRASRXGWCSSAVGGVFNLAIGLRDPHVE
NQTPEFFQDVSKPKYSGTPELGQVGXPEACPTGHFVVFSSVSAGRVGNAGQSNYGXRHSA
MERICEKRRQDGLPGLAVQWGAIGDVGIILETXGTNDTVIGGTLPXRIASCXRVLDLFLN
QPHPVLSSFGLAKKATAHDDGSSQQDLVKAHPQLPTRAPLPEHPXPATINLDSSLADLGL
DSLMSVEVRRCWTRAXLVLSMREVQQLTXRKLQELSSRRHSXWYVSLATPTPKEDXLARA
AGQLNLSTLLVNPXGPDLDAANLVQSSERPLLVHPIEGSIAVFHNLAAKLSIPTYGLQCT
EVCPVDRFPSLAAYYIECIRQVXPEGPYRIAGYSYGACVAFEMCSQLQAQQSAAPANHXL
FLFAGSHSYVLAYTQSYRAKLTPGCEAEAXAEAMCFFVQQFTDVEHGRVSAESAAALGGA
ERAAAAVEXSCRARRVDRRALSFAACSFYHRCAAAEQYMPRATYHGNVTLLXAKKGGAYG
EDLGADYNCPRCATARCRARHEGDHRTLLEGSGLESILSIIHSSLAEPRVSVRGLGHRGL
RAGRPAGGTLLPLPPLPPNSPPPRCLTCHCHAASFRLGDPPGL
NT seq 7692 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggtaatcgctggcatgtccgggaagctgcccgagtcagagaacttggag
gagttctgggccaatctcattggcggcgtggacatggtgacggacgatgataggcggtgg
aaggcaggactgtacggcctgccccggcggtcaggcaagctgaaggacctgtcccggttt
gacgcctccttcttcggagtccaccccaagcaggcgcacacaatggacccccagctgcgc
ttgctgctcgaggtcacctacgaggccatcgtggatggaggcatcaacccggcttccctt
cgggggacgaacactggtgtctgggtgggtgtgagcggctctgaggcctcagaggctctg
agccgggacccggagacactcctgggctacagcatggtgggctgccagcgtgccatgatg
gccaaccgcctctccttcttcttcaacttcagagggcccagcgtctccctggacacagcc
tgctcctccagcctactggccctgcagaacgcctaccaggccatccgcagtggggagtgc
cccgcagccatcgtgggtggcatcaacatccttctgaagcccaacacctccttgcagttc
ctgaagctgggcttgctcagccccgagggcacctgcaagtccttcgacgagacagggaac
ggctactgccgttcagaggccgtggtggctatgttgctgaccaagaagtccctggcccga
cgggtgtatgccaccatcctcaacgctggcaccaacacggacggctacaaggaggaaggc
atcaccttcccctccggggaggtgcaggagcagctcatccgctccctgtacgagccggct
gggttggcccccgagtcgctggagtacatggaagcccacggcaccggcaccaaggtgggt
gacccccaggagctgaacagcatcgtgcgagccctgtgtgccacccgccaggacccactg
ctgattgggtccaccaagtctaacatggggcacccagagcctgcctccggcctcgcagca
ctggccaaggtgctgctctccctggagcacgggctctgggcccccaatctgcacttccac
agcccgaaccccaagatcccagcactgcaggacaggcggctgcaggtggtggaccggccc
ctgcccatccgcgggggcaacgtgggcatcaactcctttggcttcggtggctccaacgtg
catgtcattctccagcccaactcccagccacccccaccccctgccccgcacactgccctg
ccccgactgctgcaggccagcgggcgcaccctcgaggccgtgcaggccctgctggagcag
ggcctccggcaccgccagaacctggcattcgtgagcatgctcaacgacatcgcagctgcc
cccccagctgccatgcccttccgcggctatgccgtgctgggcggcgagggaagcccgcaa
gatgtgcagcaggtgccggctggccagcgcccactctggttcatctgctctgggatgggt
gcgcagtggcgcgggatggggctgagcctcatgcgcctggacagcttccgtgattccatc
ctgcgctcggacgagaccgtgaagccattggggctgcaggtgtcgggcctgctgcagagc
ccagacgaggccaccttcgacgacatcgtccatgccttcgtgagcctcactgccatccag
atcgccctcatagacctgctgacctctatgggcctacggccagacggcatcattgggcac
tccctgggcgaggtggcctgcggctacgccgacggctgcctgtctcaggaggaggctgtc
ctctgcgcctactggaggggccagtgcattaaggaggccaacatcccgccaggggccatg
gcagctgtaggcttgtcctgggaggaatgtaagcagcgctgcccccctggcgtcgtgccc
gcctgccacaactccgaggacacagtgaccatctcaggacctcaggccacgatgtctgag
tttgtgcagcagctaaaacaggagggcgtgtttgccaaggaggtgcggacgggcggcctg
gctttccactcctacttcatggactccattgcgcccacactgctgcaggcgctcaagaag
gtgatccgggagccgcggccccgctccgcgcgctggctcagcacctccatccctgaggcc
cagtggcagggcagcctggcccgcacgtcctcggccgagtacaacgtcaacaacatggtg
agccctgtgctgttccaggaggcactgaggcacgtgcctgagaacgccgtggtgctggag
atcgccccccacgccctgctgcaggccatcctgaagcgcggcctgaagtccagctgcacc
atcctcccactgatgaagaaggaccacaaggacaacctggagttcttcctcagcaacatg
ggccggctccacctgacgggcatcgacgtcaaacccaatggcctgttcccgcctgtggag
ttcccggctccccgggggactcctcttatctccccccacatcaagtgggaccacagccag
acctgggacgtgcctgcctccaaagacttccccagcggctccagctgctcctccgccact
gtctacaacatagacaccagccccgagtcccccgaccactacctggtggatcactgcatc
gatggccgtgtcatcttccccgccaccggctacctgtgcctggtctggaagacactggca
cgagccctgggccaaaacatggagcaggtacctgtggtgttcgaggacgtgacgctgtac
caggccaccatcctgcccaagacagggactgtgcctctgaaagtgcggcttctggaggct
tcccacgccttcgaggtgtctaataacggcagcctgatcgtgagcgggaaggtgcgccag
tgggaggaccccaacccgaagctctttgacagccgggatagtgtggaccccgcggatccc
gtgcccatgctccggctgagcctgggggacgtgtacaaggagctacgcctgtgtggctac
gactatggcccgcacttccagggcatcctggaggccggcctggaaggcaatgcaggccgg
cttctgtggagggagaactgggtgaccttcctggacaccatgctacagatcattatcctg
ggccttggctcgcacagcttgcgcctccccactcgcatcaccgccatccacatcgacccc
accacccaccggcagaagctgtacacgctgcagggcgaggcccaagtggccagtgtggtg
gtgaacaagtgtgtgaacagcatagtagccgggggcgtcctcatgtcacgggtccactcc
tccacggcccctcggcgacaggagcagctcccgcccgtcctggagaagttctgcttcaca
ccttacgtggaggatgggtgcctggccgggaacatggccctgcaggaggggctgcagctg
tgcagggggctggcacaggcactgcagagcaaggtggcccagcaggggctgaagatggtg
gttcctgggctggacggggcccaggccccccgggaggccccacagcagggcctgcctcga
ctgttggccaccgcctgccagctgcaactcaacgggaacctacagctggagctgggccag
gtgctggcccgggagaggcccctgctgtgcgacgatcccctgctctgtggcctcctcgac
tccccggcgctcaaggcgtgtgtggacactgccctggagaacatggccagtctcacgatg
aaggtggtagaggtgctggctgctgatggccaactgtattcccgcatcccggcgctgctc
agcactcagcccctggtgaagctggactacacggtcactgaccgccacccccaggccctg
gaggctgcccaggcccagctacagcaacacaacatgacccagggccagtgggaccccatg
gacctggcccccagcagcctgggcgcggccgatctcttggtgtgtaactgtgccctggcg
acccttggcaacccagccacagccctcggcaacatggcagccaccctgaaggagggcggt
ttcctgctgctgcacaccctgctcagaggataccccctcggggagacggtcgccttcctc
acctgccctgagccacatccaggccagcagggccttctgagccaggaccagtgggaaggc
ctgtttgctggggcatccctgcacctggtggccctgaagaggtccttctacggctccgtg
ctcttcctgtgccgccggctggcccctcaggccagcccagtctttctgcctgtggaagac
accagcttccgctgggtggactcgctgaagaacattctggctgactcctcctcccagcgc
gtgtggctgatggccactggctgcaccacttcgggtgtcgtgggcatggcgaaatgtctc
cgaaaagagcccggcgggcaccggattcggtgcatcctggtatccaacctcagcagcaca
tcccccgtccctgaggtcgacccaggctccccagagctgcagaaggtgctgcagagagac
ctggtgatgaacgtctaccgggacggggcctggggggccttccaccacttcccgctggag
caggacaagccggaggagcagacagagcacgccttcgtcgacgttcttacccggggggac
ctctcctccatccgctgggtctgctcccctctgcgccatgcccagccccctggccctggt
gtccagctctgcaccatctactacgcttccctcaacttccgagacatcatgctggccacg
ggcaaactctcccctgacgccattccaggaaaacgggcggctcaggactgcttgctgggc
atggagttctctggtcgcgatgccagtggcaagcgcgtgatgggcctggtgtccgccaaa
ggcctggccacctccgtcctggtgccccaatacagcctgtgggacgtaccctccaactgg
accctggaggaggcggcctctgtgccggtcgtctacagcactgcctactatgcgctggtg
gtgcgcgggcgggtgcagcctggggagacggtgctcatccactcgggctcgggcggcgtg
gggcaggccgccatcgccatcgccctcagcctaggctgccgtgtcttcaccaccgtgggg
tcagccgcgaagcaggcatacctccaggccaggttccctcagctcaacgagaccagtttt
gccaactcccgggacacgtccttcgagcagcacgtgctgtggcacacggccgggaagggt
gagtgcgacctggtcctgaactccctggcggaggagaagctgcaggctagcgtgcggtgt
ctggcccagcatggccgcttcctggaanacggcaaattcgacctttccaacaacaacccg
ctgggcatggcgtcgttcctgaagaacgtgnactttcacgggatcctgctggacgccatc
actgagggaaactcacctgtctggcgggggggtgtcggccctgctgcaggaggcgtccag
gagggcgtagtgcagcccntcaagcgcaccgtgttccaagaccggtgggaggacgccttc
cgctacatggcccaggggaagcacattggcaaagtggtcatccaggtacacgaagaggag
ccggaagcagtggtgcggggggtgaggcccacccaacagcaggccttgtccaggaccttc
tgcctggcccacaagagcnacatcatcactgggggcctgggtggctttggcctggagctg
gcccagtggctcgtgggcgaggggcccagaagctgggtgctgacctccgcctccgggatc
cgcacaggctaccaggccaggcagatccatgcatggagacaccagggtgtgcaggtcttg
gtgtccaccagcaatgtcagctcgcggacggtgcccagagcctcacgctgaggctggtgc
agctcggcggtggggggtgtcttcaacctggccattggtctgagagacccccatgtggag
aaccagacccccgagttcttccaggatgtcagcaagcccaagtacagcggcacccctgaa
cttggacaggtggggtgaccggaggcgtgcccgaccggacacttcgtggtcttctcctcc
gtgagtgcggggcgtgtgggcaacgctggccagagcaactacggtnntcgccactctgcc
atggagcgcatttgtgagaagcgccggcaagatggcctcccaggcctcgctgtgcagtgg
ggcgccattggtgacgtgggcatcatcctggagaccntgggcaccaacgacacggtcatc
ggcgggacgctgcccnagcgcatcgcctcctgcnggagggtgctggatctcttcctgaac
cagccccacccagtcctgagcagctttgggctggccaagaaggccacagcccatgatgac
ggcagcagccagcaggatctggtgaaggcccatccccagttgccaacgagagcacccctc
cccgagcatccgtgacctgccaccatcaacctggacagctcactggcggacctgggcctg
gactcactcatgtctgtggaggtgcgcagatgctggacgcgcgcatgactggtgctgtcc
atgcgggaagtccagcagctcactncccgcaaattgcaggagctttcctcgaggcggcac
agctgatggtacgtgtcactggcgacccccacccccaaggaggacnagctcgcccgggca
gcaggccagctgaacctgagcaccctgctggtgaaccctnnggggcccgaccttgacgca
gctaacctggtgcagagctccgagaggccccttctggtgcaccccatcgaaggctccatc
gctgtgttccacaacctggctgccaagctcagcatccccacctacggcctgcagtgcacg
gaggtctgccccgtggacagattcccgagcctggccgcctactacatcgagtgcatcagg
caggtgnagcctgaggggccctaccgcattgccggctactcctacggggcctgcgtggcc
ttcgagatgtgctcacagctgcaggcccagcagagcgccgcccccgccaaccacnagctc
ttcctgttcgccggctcgcactcctacgtgctggcctacacgcagagctaccgtgccaag
ctgacccccggctgcgaggcggaggcgnnggccgaggccatgtgcttcttcgtgcagcag
ttcacggacgtggagcatggcagggtgagtgctgagagcgctgcggccctcgggggcgcg
gagcgcgcagcggccgccgtggagtgatcatgcagagcccgcagggtggaccgccgcgcg
ctcagcttcgccgcgtgctccttctaccacagatgcgccgccgcagagcagtacatgccg
cgggccacctaccacggcaatgtgacgctgctgngcgccaagaagggtggcgcctatggc
gaggacctgggcgccgactacaactgtcccaggtgtgcgacggcaaggtgtcgtgcacgt
catgagggcgaccaccgcacgctgctggagggcagcggtctggagtccatcctgagcatc
atccacagctccctggccgagccgcgcgtcagcgtgcgggggctaggccaccgtgggctg
cgtgctgggcgtcctgcgggtgggaccctcctcccgctccccccgcttccccccaactcc
ccccccccccgctgcctgacgtgccactgccatgccgccagcttccgactcggagacccg
cccggtctgtga

KEGG   Camelus dromedarius (Arabian camel): 116151509Help
Entry
116151509         CDS       T04642                                 

Definition
(RefSeq) fatty acid synthase-like
Organism
cdk  Camelus dromedarius (Arabian camel)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioesterase KR PP-binding adh_short ADH_zinc_N_2 adh_short_C2 YjeF_N
Motif
Other DBs
NCBI-GeneID: 116151509
NCBI-ProteinID: XP_031302754
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MAVFLKNVTFHGILLDAITEGNSPVWREVSALLQAGVQEGVVQPLKRTVFPKTQVEDAFR
YMAQGKHIGKVVIQVHEEEPEAVVRGVRPTPTAALSRTFCLAHKSYIITGGLGGFGLELA
QWLVVRGAQKLVLTSRSGIRTGYQARQIHAWRHQGVQVLVSTSNVSSPDGAQSLIAEAVQ
LGPVGGVFNLAMVLRDAMLENQTPEFFQDVSKPKYSGTLNLDRVTREACPDLDYFVVFSS
VSCGRGNAGQSNYGFANSAMERICEKRRQDGLPGLAVQWGAIGDVGIILETLGTNDTVIG
GTLPQRIASCLEVLDLFLNQPHPVLSSFVLAKKATAHDDGSSQQDLVKAVAHILGIRDLA
TINLDSSLADLGLDSLMSVEVRQMLEREHELVLSMREVQQLTLRKLQELSSQAGTADELA
TPTPKEDSSARQQAQLNLSTLLVNPEGPTLTQLNLVQSSERPLFLVHPIEGSIAVFHNLA
AKLSIPTYGLQCTRAAPLDSIPSLAAYYIECIRQVQPEGPYRIAGYSYGACVAFEMCSQL
QAQQSAAPANHSLFLFDGSHSYVLAYTQSYRAKLTPGCEAEAEAEAMCFFVQQFTDVEHG
RVLEALLPLGGLEERAAAAVELIMQSHAGLDRRALSFAACSFYHKLRAAEQYMPRATYHG
NVTLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESILSIIHSSL
AEPRVSVREG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcctgaagaacgtgaccttccacgggatcctgctggacgccatcactgag
ggaaactcacctgtctggcgggaggtgtcggccctgctgcaggcaggcgtccaggagggc
gtagtgcagcccctcaagcgcaccgtgttccctaagacccaggtggaggacgccttccgc
tacatggcccaggggaagcacattggcaaagtggtcatccaggtacacgaagaggagccg
gaagcagtggtgcggggggtgaggcccaccccaacagcggccttgtccaggaccttctgc
ctggcccacaagagctacatcatcactgggggcctgggtggctttggcctggagctggcc
cagtggctcgtggtgcgaggggcccagaagctggtgctgacctcccgctccgggatccgc
acaggctaccaggccaggcagatccatgcatggagacaccagggtgtgcaggtcttggtg
tccaccagcaatgtcagctcgccggacggtgcccagagcctcatcgctgaggctgtgcag
ctcgggcctgtggggggtgtcttcaacctggccatggtcctgagagacgccatgctggag
aaccagacccccgagttcttccaggatgtcagcaagcccaagtacagcggcaccctgaac
ttggacagggtgacccgggaggcgtgccccgacctggactacttcgtggtcttctcctcc
gtgagctgcgggcgtggcaacgctggccagagcaactacggcttcgccaactctgccatg
gagcgcatttgtgagaagcgccggcaagatggcctcccaggcctcgctgtgcagtggggc
gccattggtgacgtgggcatcatcctggagaccttgggcaccaacgacacggtcatcggc
gggacgctgccccagcgcatcgcctcctgcctggaggtgctggatctcttcctgaaccag
ccccacccagtcctgagcagctttgtgctggccaagaaggccacagcccatgatgacggc
agcagccagcaggatctggtgaaggccgtggctcacattctgggcatccgtgacctcgcc
accatcaacctggacagctcactggcggacctgggcctggactcactcatgtctgtggag
gtgcgccagatgctggagcgcgagcatgagctggtgctgtccatgcgggaagtccagcag
ctcactctccgcaaattgcaggagctttcctcgcaggctggcacagctgatgagctggcg
acccccacccccaaggaggacagctccgcccggcagcaggcccagctgaacctgagcacc
ctgctggtgaaccctgagggcccgaccttgacgcagctcaacctggtgcagagctccgag
aggccccttttcctggtgcaccccatcgaaggctccatcgctgtgttccacaacctggct
gccaagctcagcatccccacctacggcctgcagtgcacgagagctgccccgctggacagc
atcccgagcctggccgcctactacatcgagtgcatcaggcaggtgcagcctgaggggccc
taccgcattgccggctactcctacggggcctgcgtggccttcgagatgtgctcacagctg
caggcccagcagagcgccgcccccgccaaccacagcctcttcctgttcgacggctcgcac
tcctacgtgctggcctacacgcagagctaccgtgccaagctgacccccggctgcgaggcg
gaggccgaggccgaggccatgtgcttcttcgtgcagcagttcacggacgtggagcatggc
agggtgctggaggcgctgctgcccctcgggggcctggaggagcgcgcagcggccgccgtg
gagctgatcatgcagagccacgcaggcctggaccgccgcgcgctcagcttcgccgcgtgc
tccttctaccacaagctgcgcgccgcagagcagtacatgccgcgggccacctaccacggc
aatgtgacgctgctgcgcgccaagacgggtggcgcctatggcgaggacctgggcgccgac
tacaacctgtcccaggtgtgcgacggcaaggtgtccgtgcacgtcattgagggcgaccac
cgcacgctgctggagggcagcggtctggagtccatcctgagcatcatccacagctccctg
gccgagccgcgcgtcagcgtgcgggagggctag

KEGG   Camelus dromedarius (Arabian camel): 116151891Help
Entry
116151891         CDS       T04642                                 

Definition
(RefSeq) fatty acid synthase-like
Organism
cdk  Camelus dromedarius (Arabian camel)
SSDB OrthologParalogGFIT
Motif
Pfam: KR PP-binding adh_short adh_short_C2 YjeF_N
Motif
Other DBs
NCBI-GeneID: 116151891
NCBI-ProteinID: XP_031303243
LinkDB All DBs
Position
Unknown
AA seq 412 aa AA seqDB search
MAQGKHIGKVVIQVHEEEPEAVVRGVRPTPTAALSRTFCLAHKSYIITGGLGGFGLELAQ
WLVVRGAQKLVLTSRSGIRTGYQARQIHAWRHQGVQVLVSTSNVSSPDGAQSLIAEAVQL
GPVGGVFNLAMVLRDAMLENQTPEFFQDVSKPKYSGTLNLDRVTREACPDLDYFVVFSSV
SCGRGNAGQSNYGFANSAMERICEKRRQDGLPGLAVQWGAIGDVGIILETLGTNDTVIGG
TLPQRIASCLEVLDLFLTQPHPVLSSFVLAKKATAHDDGSSQQDLVKAVAHILGIRDLAT
INLDSSLADLGLDSLMSVEVRQMLEREHELVLSMREVQQLTLRKLQELSSQAGTADELAT
PTPKEDSSARQQAQLNLSTLLVNPEGPTLTQLNLVQSSERPLFPSSTNRNRL
NT seq 1235 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggaagcacattggcaaagtggtcatccaggtacacgaagaggagccggaa
gcagtggtgcggggggtgaggcccaccccaacagcggccttgtccaggaccttctgcctg
gcccacaagagctacatcatcactgggggcctgggtggctttggcctggagctggcccag
tggctcgtggtgcgaggggcccagaagctggtgctgacctcccgctccgggatccgcaca
ggctaccaggccaggcagatccatgcatggagacaccagggtgtgcaggtcttggtgtcc
accagcaatgtcagctcgccggacggtgcccagagcctcatcgctgaggctgtgcagctc
gggcctgtggggggtgtcttcaacctggccatggtcctgagagacgccatgctggagaac
cagacccccgagttcttccaggatgtcagcaagcccaagtacagcggcaccctgaacttg
gacagggtgacccgggaggcgtgccccgacctggactacttcgtggtcttctcctccgtg
agctgcgggcgtggcaacgctggccagagcaactacggcttcgccaactctgccatggag
cgcatttgtgagaagcgccggcaagatggcctcccaggcctcgctgtgcagtggggcgcc
attggtgacgtgggcatcatcctggagaccttgggcaccaacgacacggtcatcggcggg
acgctgccccagcgcatcgcctcctgcctggaggtgctggatctcttcctgacccagccc
cacccagtcctgagcagctttgtgctggccaagaaggccacagcccatgatgacggcagc
agccagcaggatctggtgaaggccgtggctcacattctgggcatccgtgacctcgccacc
atcaacctggacagctcactggcggacctgggcctggactcactcatgtctgtggaggtg
cgccagatgctggagcgcgagcatgagctggtgctgtccatgcgggaagtccagcagctc
actctccgcaaattgcaggagctttcctcgcaggctggcacagctgatgagctggcgacc
cccacccccaaggaggacagctccgcccggcagcaggcccagctgaacctgagcaccctg
ctggtgaaccctgagggcccgaccttgacgcagctcaacctggtgcagagctccgagagg
ccccttttcccctcatctacaaacagaaacagact

DBGET integrated database retrieval system