KEGG   Camelus dromedarius (Arabian camel): 105101547
Entry
105101547         CDS       T04642                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04140  Autophagy - animal
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05010  Alzheimer disease
cdk05014  Amyotrophic lateral sclerosis
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05145  Toxoplasmosis
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05165  Human papillomavirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105101547 (BAD)
   04014 Ras signaling pathway
    105101547 (BAD)
   04370 VEGF signaling pathway
    105101547 (BAD)
   04024 cAMP signaling pathway
    105101547 (BAD)
   04022 cGMP-PKG signaling pathway
    105101547 (BAD)
   04151 PI3K-Akt signaling pathway
    105101547 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105101547 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    105101547 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105101547 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    105101547 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105101547 (BAD)
   04919 Thyroid hormone signaling pathway
    105101547 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105101547 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101547 (BAD)
   05203 Viral carcinogenesis
    105101547 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105101547 (BAD)
   05212 Pancreatic cancer
    105101547 (BAD)
   05225 Hepatocellular carcinoma
    105101547 (BAD)
   05221 Acute myeloid leukemia
    105101547 (BAD)
   05220 Chronic myeloid leukemia
    105101547 (BAD)
   05218 Melanoma
    105101547 (BAD)
   05211 Renal cell carcinoma
    105101547 (BAD)
   05215 Prostate cancer
    105101547 (BAD)
   05213 Endometrial cancer
    105101547 (BAD)
   05223 Non-small cell lung cancer
    105101547 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105101547 (BAD)
   05014 Amyotrophic lateral sclerosis
    105101547 (BAD)
   05020 Prion disease
    105101547 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    105101547 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105101547 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105101547 (BAD)
   05161 Hepatitis B
    105101547 (BAD)
   05160 Hepatitis C
    105101547 (BAD)
   05162 Measles
    105101547 (BAD)
   05168 Herpes simplex virus 1 infection
    105101547 (BAD)
   05165 Human papillomavirus infection
    105101547 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105101547 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105101547 (BAD)
   01524 Platinum drug resistance
    105101547 (BAD)
   01522 Endocrine resistance
    105101547 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 105101547
NCBI-ProteinID: XP_031303754
LinkDB
Position
Unknown
AA seq 179 aa
MDRLSFLPAQSMFQIPEFEQSEQEESSPADRGLGPNPTGDRAPGPGKHCRTATGLLGEAG
HQQGQPANSNYHGGAGAVETRSRHSSHPTGTEDEEGTEEEEPSPFRGRSRSAPPNLWAAQ
RYGRELRRMSDEFHGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWGRNLGRGGSAPSQ
NT seq 540 nt   +upstreamnt  +downstreamnt
atggatagactgagcttcctgccagcccagagcatgttccagatcccagaatttgagcag
agtgagcaggaagaatccagccctgcagataggggcctgggccccaaccccactggggac
agggccccaggtcccggcaagcactgccgaacagccacaggcctcctgggggaagctggt
caccagcaggggcaaccggccaacagcaactaccatggaggcgctggggctgtggaaacc
aggagtcgccacagctcccacccaacggggaccgaggacgaagaagggacggaggaggag
gagcccagccccttccggggccgctcgcgctcagcgccccccaacctctgggctgcacag
cgctatggccgcgagctccggaggatgagcgacgagttccacggctccttcaagggactc
cctcgcccgaagagcgctggcaccgcgacacagatgcggcaaagtcccagctggacgcgc
ttcatccagtcctggtggggccggaacttggggagaggcggctccgccccctcccagtga

DBGET integrated database retrieval system