KEGG   Camelus dromedarius (Arabian camel): 105101591Help
Entry
105101591         CDS       T04642                                 

Gene name
ACADL
Definition
(RefSeq) long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform X1
  KO
K00255  long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
Module
cdk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105101591 (ACADL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105101591 (ACADL)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.8  long-chain acyl-CoA dehydrogenase
     105101591 (ACADL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 105101591
NCBI-ProteinID: XP_031307703
LinkDB All DBs
Position
5
AA seq 432 aa AA seqDB search
MATRLRGALRLWGGRSAPPWPRVARCSHSRGEERLETPSAKKLTDVGIRRIFSSEHDIFR
KSVRKFFQEEVSPHHTEWEKAGEVSRELWEKAGKQGLLGINIAERHGGIGGDLYSSAVVW
EEQAYSNCTGPGFSLHSDIIMPYIANYGSEEQIKHFIPQMTAGKCIGAIAMTEPGAGSDL
QGVRTNAKKDGSDWILNGSKVFVSNGWLSDLVIVVAVTNREARSPAHGISLFLVENGMKG
FIKGRKLQKMGLKAQDTAELFFEDVRLPASALLGEENKGFYYIMKELPQERLLIAELAVS
ASEFMFEETRNYVKQRKAFGKTVAHIQTVQHKLAELKTHICVTRAFVDSCLQLHETKRLD
SATASMAKYWASELQNSVAYDCVQLHGGWGYMWEYPIAKLSYILCVCVLLGSDQRELMWM
PEFSQSMVVPMK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggccacacgcctccgcggggccctgcgcttgtggggcggccgctctgcgccgccctgg
ccgcgggtcgcgagatgttctcattcccgaggggaggaacgtctagaaactccttctgct
aaaaaattaaccgatgtaggaattagaagaatcttctcttcagagcatgacattttccgg
aaaagtgtaaggaagttttttcaagaagaagtgagccctcatcacacagaatgggagaaa
gctggagaagtgagcagggagctttgggaaaaagctggaaaacaaggactgctgggcatc
aatattgcagagcgtcatggtggcattgggggggacttgtactcgtcagctgttgtttgg
gaggagcaggcatattcgaattgcacaggcccaggttttagtcttcattcggatattatc
atgccctatattgcgaactatggctcagaagaacagattaagcactttatcccccagatg
actgcagggaagtgtattggtgccatagcaatgacagagcctggggcaggaagtgatttg
cagggagtaagaacaaatgccaaaaaggatggaagtgactggattctcaatggaagcaag
gtgttcgtctcaaatgggtggctgagtgacttggtgatcgtagtggcagtcacaaatcgt
gaagctcgctcccctgcccatggcattagcctttttctggtggaaaatgggatgaaagga
tttatcaagggacgaaagctccagaaaatgggactgaaagcccaggatactgcagaatta
ttctttgaagatgtacggttgccagcgagtgccctacttggagaagagaataaaggattc
tattacatcatgaaagagcttccacaggaaaggctgttgattgctgagttggcagtttca
gccagtgaattcatgtttgaagaaaccaggaactacgttaaacaaagaaaagcttttggg
aaaacagttgcacatatacagacggtgcagcataagctagcagaattaaaaacacacatt
tgtgtaacgagagcttttgtggacagctgtctccagctgcatgaaacgaaacgtctggac
tctgccactgcttccatggcgaaatattgggcatccgagttacaaaacagtgtagcttat
gactgtgtgcagctgcatggaggttggggatacatgtgggagtacccaattgcaaaatta
agctatatattgtgtgtgtgtgtgttgctgggctcagatcaaagagagcttatgtggatg
cccgagttcagccaatctatggtggtaccaatgaaataa

DBGET integrated database retrieval system